KEGG   Pongo abelii (Sumatran orangutan): 100441641Help
Entry
100441641         CDS       T01416                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta-2 isoform X1
  KO
K06243  laminin, beta 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100441641 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100441641 (LAMB2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100441641 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100441641 (LAMB2)
   05222 Small cell lung cancer
    100441641 (LAMB2)
  Infectious diseases
   05165 Human papillomavirus infection
    100441641 (LAMB2)
   05146 Amoebiasis
    100441641 (LAMB2)
   05145 Toxoplasmosis
    100441641 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N APG6 Sec5 F5_F8_type_C
Motif
Other DBs
NCBI-GeneID: 100441641
NCBI-ProteinID: XP_024100812
Ensembl: ENSPPYG00000013880
Position
3
AA seq 1802 aa AA seqDB search
MELTSREGGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPVPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGYSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPG
STPCDPSSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQVPYRCDE
ATGQCHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTLGETPSWTG
SGFVRLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGH
LVAKDDRIQGTLQPHARYMMFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLID
SLVLLPHVLVLEMFSGGDAAALERRATFERYQCHEEGLVPSKTSPSEACAPLLISLSTLI
YNGALPCQCNPQGSLSSECNPHGGQCLCKPGVVGRCCDLCASGYYGFGPTGCQACQCSHE
GALSSLCEKTSGQCPCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGC
RDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQQIVCHC
RAGYTGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEG
PHCAHCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSC
DRCAPNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDP
GLQCRACDCDSRGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGD
WDRVVQDLAARTRRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTA
QLVEATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSGLERDRIALNLTLRQLHQ
HLDLLKHSNFLGAYDSIRHAHRQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQK
EDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGASCRDEDGQPR
CGGLSCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALD
KANASRGQVEQANQELRELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLA
SAIAERVRSLADVDAILARTVGDVRRAEQLLQDARRARSRAEDEKQKAETVQEALEEAQR
AQGVAQGAIRGAVADTQDTEQTLYQVQERMAGAEQALSSAGERARQLDALLEALKLKRAG
NSLAASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRD
EARDLLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNT
CQ
NT seq 5409 nt NT seq  +upstreamnt  +downstreamnt
atggagctgacctcaagggaaggagggaggggacagcctctgccctgggaacttcgactg
ggcctactgctaagcgtgctggctgccacactggcacaggcccctgccccggatgtgcct
ggctgttccaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacctgtggcctgaatggcccccagccctattgcatcgtcagt
cacctgcaggacgaaaagaagtgcttcctttgtgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaatgtagtcaccagctttgcaccacagcggcgg
gcagcctggtggcagtcagagaatggtatccctgcggtcaccatccagctggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcccccccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgt
gtgctggaccctgccatccctgtcccagacccctacagctcacggattcagaacctgttg
aagatcaccaacctacgggtgaacctgactcgtctacacacgttgggagacaacctactc
gacccacggagggagatccgagagaagtactactatgccctctatgagctggttgtacgt
ggcaactgcttctgctacggacacgcctcagagtgtgcacccgccccaggggcaccagcc
catgccgagggcatggttcacggagcttgcatctgcaaacacaacacacgtggcctcaac
tgtgagcagtgtcaggatttctatcatgacctgccctggcatccagctgaggacggctat
agtcatgcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatg
gccgtatacctggcatctggcaacgtgagtggaggtgtgtgtgatggatgtcagcataac
acagctgggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaggac
ctgcgggatccggctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggt
ggtcgctgtgattcccatgatgaccctgcactgggactggtctccggccagtgtcgctgc
aaagaacatgtggtgggcactcgctgccagcaatgccgtgatggcttctttgggcttagc
atcagtgaccctctgggctgccggcgatgtcaatgtaatgcacggggcacagtgcctggg
agcactccttgtgaccccagcagtggatcctgttactgcaaacgtctagtgactggacgt
ggatgtgaccgctgcctgcctggccactggggcctgagccacgacctgcttggctgccgc
ccctgtgactgcgacgtgggtggtgccttggatccccaagttccctacaggtgtgatgag
gccacaggtcaatgccactgccgccagcacatggttgggcgacgctgtgagcaggtgcaa
cctggctacttccggcccttcctggaccacctaatttgggaggctgaggacacccgaggg
caggtgctcgatgtggtggagcgcctggtgacccttggggaaactccatcctggactggc
tcaggctttgtgcggctacaggaaggtcagaccctggagttcctggtggcctctgtgccg
aaggccatggactatgacctgctgctgcgcttagagccccaggtccctgagcaatgggca
gagttggaactgattgtgcagcgtccagggcctgtgcctgcccacagcctgtgtgggcat
ttggtggccaaggatgaccgcatccaagggactctgcaaccacacgccaggtacatgatg
tttcctaatcctgtctgccttgagcctggtatctcctacaagctgcatctgaagctggta
cggacagggggaagtgcccagcctgagactccctactctggacctggcctgctcattgac
tcgctggtgctgctgccccatgtcctggtgctagagatgtttagtgggggtgatgctgct
gccctggagcgccgggccacctttgaacgctaccaatgccatgaggagggtctggtgccc
agcaagacttctccctctgaggcctgcgcgcccctcctcatcagcctgtccacccttatc
tacaatggtgccctgccatgtcagtgcaaccctcaaggttcactgagttctgagtgcaac
cctcatggtggtcagtgcctgtgcaagcctggagtggttgggcgctgctgtgacctctgt
gcctctggctactatggctttggccccacaggctgtcaagcctgccagtgcagccatgag
ggggcactcagcagtctctgtgaaaagaccagtgggcaatgtccctgtcgaactggtgcc
tttgggcttcgctgtgaccgctgccagcgtggccagtggggattccctagctgccggcca
tgtgtctgcaatgggcatgcagatgagtgcaacacccacacaggcgcttgcctgggctgc
cgtgatcacacagggggtgagcactgtgaaaggtgcattgctggtttccatggggaccca
cggctgccatatgggggccagtgccggccctgtccctgtcctgaaggccctgggagccaa
cggcactttgctacttcttgccaccgggatgaatattcccagcagattgtgtgccactgc
cgggcaggctacacggggctgcgatgtgaagcttgtgcccctgggcactttggggaccca
tcaaggccaggtggccggtgccaactgtgtgagtgcagtgggaacattgacccaatggat
cctgatgcctgtgacccccacacggggcaatgcctgcgctgtttacaccacacagagggt
ccacactgtgcccactgcaagcctggcttccatgggcaggctgcccgacagagctgtcac
cgctgcacatgcaatctgctgggcacaaatccccagcagtgcccatctcctgaccagtgc
cactgtgatccaagcagtgggcagtgcccatgcctccccaatgtccagggccctagctgt
gaccgctgtgcccccaacttctggaacctcaccagcggccatggttgccagccttgtgcc
tgccacccaagccgggccagaggccccacctgcaatgagttcacagggcagtgccactgc
cgtgcaggctttggagggcggacttgttctgagtgccaagagctccactggggagaccct
gggttgcagtgccgtgcctgtgattgtgactctcgtggaatagatacacctcagtgtcac
cgctccacaggccactgcagctgccgcccaggggtgtctggtgtgcgctgtgaccagtgt
gcccgtggcttctcaggaatctttcctgcctgccatccctgccatgcatgcttcggggat
tgggaccgagtggtgcaggacttggctgcccgtacacggcgcctagagcagcgggcgcag
gagttgcagcagacgggtgtgctgggtgcctttgagagcagcttctggcatatgcaggag
aagctgggcattgtgcagggcatcgtaggtgcccgcaacacctcagccgcctccaccgca
cagcttgtggaggccacagaggagctgcggcgtgaaattggggaggccactgagcacctg
actcagctcgaggcagagctgacagatgtgcaagatgagaacttcaatgccaaccatgca
ctaagcggtctggagcgagacaggattgcacttaatctcacactgcggcagctccaccag
catcttgacttgctcaaacattcaaacttcctgggtgcctatgacagcatccggcatgcc
cataggcagtctgcagaggcagaacgtcgtgccaatacctcagccctggcagtacctagc
cctgtgagcaattcggcaagtgctcggcatcggacagaggcactgatggatgctcagaag
gaggacttcaacagcaaacacatggccaaccagcgggcactcggcaagctctctgcccat
acccacaccctaagcctaacagacataaatgagctggtgtgtggggcaccaggggatgca
ccctgtgctacaagcccttgtgggggtgccagctgtcgagatgaggatgggcagccccgc
tgtgggggcctcagctgcaatggggcagcggctacagcagacctagcactgggccgggcc
cggcacacacaggcagagctgcagcgggcactggcagaaggtggtagcatcctcagcaga
gtggctgagactcgtcggcaggcaagcgaggcacagcagcgggcccaggcagccctggac
aaggctaatgcttccaggggacaggtggaacaggccaaccaggaacttcgagaacttatc
cagagtgtgaaagacttcctcaaccaggagggggctgatcctgatagcattgaaatggtg
gccacacgggtgctagagctctccatcccagcttcagctgagcagatccagcacctggca
agtgcaattgcagagcgagtccggagcctggcggatgtggacgcgatcctggcacgtact
gtaggagatgtgcgtcgtgccgagcagctactgcaggatgcacggcgggcaaggagccgg
gctgaggatgagaaacagaaggcagagacagtacaggaagcactggaggaggcccagcgg
gcacagggtgttgcccagggtgccatccggggggcagtggctgacacacaggacacagag
cagaccctgtaccaggtacaggagaggatggcaggtgcagagcaggcactgagctctgca
ggtgaaagggctcggcagttggatgctctcctggaggctctgaaattgaaacgggcggga
aatagtctggcagcctctacagcagaagaaacagcaggcagtgcccagggtcgtgcccag
gaggctgagcagctgctacggggccctctgggtgatcagtaccagacggtgaaggccctg
gctgagcgcaaggcccagggtgtgctggctgcacaggcaagggcagaacaactgcgggat
gaggctcgggacctgttgcaagccgctcaggacaagctgcagcggctacaggaattggaa
ggcacctatgaggaaaatgagcgggcactggagagtaaggcagcccagctggacgggttg
gaggccaggatgcgcagcgtgcttcaagccatcaacttgcaggtgcagatctacaacacc
tgccagtga

DBGET integrated database retrieval system