KEGG   Pongo abelii (Sumatran orangutan): 100441869Help
Entry
100441869         CDS       T01416                                 

Gene name
SLC9A3R2
Definition
(RefSeq) solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
  KO
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100441869 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 269 aa AA seqDB search
LPQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHYPWEPKPDWAHT
GGRSSDAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARS
GLRAQDRLIEVNGQNVEGLRHADVVASIKAQEDEARLLVVDPKTDEHFKRLRVTPTEEHV
EGPLPSPVTNGTSPAQLIGGSACSSRSDLPGSDKDTEDGSAWKRDPFQESGLHLSPTAAE
AKEKARATRVNKRAPQMDWNRKREIFSNF
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgccccaggtggtgcaaaggatcaaggctgtggaggggcagacccggctgctggtggtg
gaccaggagacagatgaagagctccgccggcggcagctgacctgcacggaggagatggcc
cagcgagggctcccacccgcccactacccctgggagccgaagccggactgggcacacacg
ggcggccgcagctccgatgctggcaagaaggatgtcagtgggcccctgagggagctgcgc
cctcggctctgccacctgcgaaagggacctcagggctatgggttcaacctgcatagcgac
aagtcccggcctggccagtacatccgctccgtggacccgggctcacctgccgcccgctct
ggcctccgcgcccaggaccggctcattgaggtgaacgggcagaatgtggagggactgcgc
cacgctgatgtggtggccagcatcaaggcacaggaggatgaggcccggctgctggtggtg
gaccccaagacagatgagcacttcaagcggcttcgggtcacacccaccgaggagcacgtg
gaaggtcctctgccgtcacccgtcaccaatggaaccagccctgcccagctcattggtggc
tctgcgtgctcgtcccgaagtgacctgcctggttccgacaaggacactgaggatggcagt
gcctggaagcgagatcccttccaggagagcggcctccacctgagccccacggcggccgag
gccaaagagaaggctcgagccacgcgagtcaacaagcgcgcgccacagatggactggaac
aggaagcgcgaaatcttcagcaacttctga

DBGET integrated database retrieval system