KEGG   Pongo abelii (Sumatran orangutan): 100441958Help
Entry
100441958         CDS       T01416                                 

Gene name
GUK1
Definition
guanylate kinase 1
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100441958 (GUK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100441958 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 218 aa AA seqDB search
MLRRPLAGLAAAALGRAPPDGMSGPRPVVLSGPSGAGKSTLLKRLFQEHSGIFGFSVSHT
TRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVQAVQAMNRICV
LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRRRNTETEESLAKRLAAAQADMESS
KEPGLFDVVIVNDSLDQAYAELKEALSEEIKKAQRTGA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgcccgctggccgggctggcagcggccgccctgggccgggccccgccggac
ggcatgtcgggccccaggcctgtggtgctgagcgggccttcgggagctgggaagagcacc
ctgctgaagaggctgttccaggagcacagcggcatctttggcttcagcgtgtcccatacc
acaaggaacccgaggcccggcgaggagaacggcaaagattactactttgtaaccagggag
gtgatgcagcgtgacatagcagccggcgacttcatcgagcatgccgagttctcggggaac
ctgtatggcacgagcaaggcggcggtgcaggccgtgcaggccatgaaccgcatctgcgtg
ctggacgtggacctgcagggtgtgcggaacatcaaggccaccgatctgcggcccatctac
atctctgtgcagccgccttcactgcatgtgctggagcagcggctgcggcggcgcaacact
gaaacggaggagagcctggcgaagcggctggctgctgcccaggccgacatggagagcagc
aaggagcctggcctgtttgatgtggtcatcgttaatgacagcctggaccaggcctacgca
gagctgaaggaggcgctctctgaggaaatcaagaaagctcaaaggaccggcgcctga

DBGET integrated database retrieval system