KEGG   Pongo abelii (Sumatran orangutan): 100442002Help
Entry
100442002         CDS       T01416                                 

Gene name
USP19
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 19 isoform X1
  KO
K11847  ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100442002 (USP19)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100442002 (USP19)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100442002 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH USP19_linker CS UCH_1 zf-MYND USP7_C2
Motif
Other DBs
NCBI-GeneID: 100442002
NCBI-ProteinID: XP_024100815
Ensembl: ENSPPYG00000013881
Position
3
AA seq 1386 aa AA seqDB search
MSGGASATGPRRGPPGLEDATSKKKQKDRANQESKDGDPRKETGSRSVAQAGLELLASGD
PSASASHAAGITGSRHRTRLFFPSSSGSASTPQEEQTKEGACEDPHDLLATPPPELLLDW
RQSAEEVIVKLRVGVVPLQLEDVDAAFTDTDCVVRFAGGQQWGGVFYAEIKSSCAKVQTR
KGSLLHLTLPKKVPMLTWPSLLKKPLGTQELVLGLQCQENGQELSPIALEPGPEPHRAKQ
EARNQKRAQGRGEVGSGAGPGAQAGPSAKRAVHLCRGPEGEGSRDDPGPRGDAPPFVADP
ATQVEADEQLCIPPLNPQTCLLGSEENLAPLAGEKAVPPGNDAVSPAMVRSRNPGKDDCA
KEEMAVAADAATLVDGKEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFRE
QDFTLIFQTRDGNFLRLHPGCGPQATFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQS
QRWGGLEAPAARGAVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQEEARAVEKDKSKARSE
DTGLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPG
FTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLLR
ALWKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTET
VDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVP
LPQKQKVLPVFYFAREPHSKPIKFLVSISKENSTASEVLDSLSQNVHVKPENLRLAEVIK
NRFHRVFLPSHSLDTVSPSDMLLCFELLSSELAKERVVVLEVQQRPQVPSVPISKCAACQ
RKQQSEDEKLKRCTRCYRVGYCNQLCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYAR
LAQLLEGYARYSVSVFQPPFQPGRMALESQSPGCTTLLSTGSLEAGDSERDPIQPPELQL
VTPMAEGDTGLPRVWAAPDRGPVPSTSGISSEMLASGPIEVGSLPAGERVSRPEAAVPGY
QHPSEAMNAHTPQFFIYKIDSSNREQRLEDKGDTPLELGDDCSLALVWRNNERLQEFVLV
ASKELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLL
LWRLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVI
NHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRN
SPVERPPRAGHSEHHPDLGPAAEAAASQGLGPGQAPEVAPTRTAPERFAPPVDRPAPTYS
NMEEVD
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggggccagtgccacaggcccaaggagagggcccccaggactggaggacgcc
actagtaagaagaagcagaaggatcgagcaaaccaggagagcaaggatggagatcctagg
aaagagacagggtctcgatctgttgcccaggctggtcttgaacttctggcctcaggtgat
ccttctgcctcagcctcccatgcagctgggatcacaggctcacgccaccgtacccggctg
ttctttccttcatcatcagggtcagcatccactcctcaagaggagcagaccaaagaggga
gcttgtgaagaccctcatgatctcttggctactccccctccagagttgttgctcgattgg
aggcagagtgcagaagaggtgattgtcaagcttcgtgtgggagtagttcccctgcagctg
gaggatgtagatgctgctttcacagatacggactgtgtggtgcggtttgcaggtggtcag
cagtggggtggtgtcttctatgctgagataaaaagctcttgtgctaaagtgcaaacccgc
aagggcagtctcctgcacctgacactgcccaaaaaggtgcctatgctcacgtggccctcc
ctcctgaagaaacctctagggacccaggagctggtgctggggctgcagtgccaggagaat
gggcaggaactgtctcccattgccctggagccaggccctgagccccaccgggctaagcag
gaggcccggaaccagaagcgggcccagggccgtggtgaggtaggctcaggggctggcccc
ggggcccaggcagggcccagcgccaagagggctgtgcatctctgcagagggccagagggg
gaagggtccagggatgaccctggaccccggggtgatgccccacccttcgtggctgaccca
gccacccaggttgaggctgatgaacagctttgcataccaccgctgaacccccaaacctgc
ctcctgggctcagaggagaatttagcccctttggcaggagagaaagcagtgcctcccggg
aatgacgcagtctctccagccatggtccggagcagaaaccctgggaaagatgactgtgcc
aaggaggagatggcagtggcagcagatgctgcaaccttggtggatggtaaagagcctgag
tcgatggtgaacctggcatttgtcaagaatgactcgtatgagaagggcccggattcagtg
gtggtgcacgtgtacgtgaaggagatctgcagggacacctcgagagtacttttccgtgag
caggacttcacgctcatcttccagaccagggatggaaacttcctgaggctgcacccaggc
tgtgggccccaagccaccttccgttggcaggtgaagctcaggaatctgattgagccagag
cagtgcaccttctgtttcacggcttctcgcatcgacatctgccttcgtaagaggcagagt
cagcgctgggggggcctggaggccccggctgcacgaggtgcagtgggtggtgcaaaggtt
gccgtgccgacaggtccaactcctctggattcaaccccaccaggaggtgctccccacccc
ctgacaggccaagaggaggcccgggctgtggagaaggataaatccaaggcacgatctgag
gacacggggctagacagtgtggcaacccgcacacccatggagcatgtaaccccaaagcca
gagacacacctggcctcgcccaagcctacatgcatggtgcctcccatgccccacagccca
gttagtggagacagcgtggaggaggaggaagaggaagagaagaaggtgtgtctgccaggc
ttcactggccttgtcaatttaggcaacacctgcttcatgaacagcgtcattcagtctctg
tccaacactcgggaactccgggacttcttccatgaccgctcctttgaggctgagatcaac
tacaacaacccactagggactggtgggcgtctggccattggctttgccgtgctgcttcgg
gcgctgtggaagggcacccaccatgccttccagccttccaaattgaaggccattgtggcg
agtaaggccagccagttcacaggctatgcacagcatgatgcccaggagttcatggctttc
ctgctggatgggctgcacgaggacctgaatcgcattcagaacaagccctacacagagacc
gtggattcagatgggcggcccgatgaggtggtagctgaggaagcatggcagcggcacaag
atgaggaatgactctttcatcgtggacctatttcaggggcagtacaagtcaaagctggtg
tgccctgtgtgtgccaaggtctccatcacttttgacccgtttctttatctgccagtgccc
ttgccacaaaagcaaaaggttctccctgtcttttattttgcccgagagccccacagcaag
cccatcaagttcctggtgagcatcagcaaggagaactccactgcgagcgaagtattggac
tccctctctcagaacgttcatgtgaagcctgagaacctgcgtttggcggaggtaattaag
aatcgtttccatcgtgtgttcctaccctcccactcactggacactgtgtccccatctgat
atgctcctctgctttgagctgctatcctcagagttggctaaggagcgggtagtggtgcta
gaggtgcaacagcgcccccaggtgcccagcgtccccatctccaagtgtgcagcctgccag
cggaagcaacagtcggaggatgagaagctgaagcgctgtacccggtgctaccgtgtgggc
tactgcaaccagctctgccagaaaacccactggcctgaccacaagggcctctgccgacct
gagaacattggctaccccttcctggtcagtgtacctgcctcacgcctcacttatgcccgc
ctcgctcagttgctagagggctatgcccggtactctgtgagtgtattccagccacccttt
cagccaggccgcatggccttggagtctcagagccctggctgcaccacactgctctccact
ggctccctggaggctggggacagcgagagggaccccattcagccacctgagctccagctg
gtgacccctatggctgagggggacacagggcttccccgggtgtgggcagcccctgaccgg
ggtcctgtgcccagcaccagtggaatttcttctgagatgctggccagtgggcccattgag
gttggctccttgcctgctggcgagagggtgtcccgacccgaagctgctgtgcctgggtac
cagcatccaagtgaagctatgaatgcccacacaccccagttcttcatctataaaattgac
tcatccaaccgagagcagcggctagaggacaaaggagacaccccactggagctgggtgac
gactgtagcctggctctcgtctggcggaacaatgagcgcttgcaagagtttgtgttggta
gcctccaaggagctggaatgtgctgaggatccaggctctgctggtgaggctgcccgggcc
ggccacttcaccctggaccagtgcctcaacctcttcacacggcctgaggtgctggcaccc
gaggaggcctggtactgcccacagtgcaaacagcaccgtgaggcctccaagcagctgttg
ctatggcgcctgccaaatgttctcatcgtgcagctcaagcgcttctcctttcgtagtttt
atttggcgtgacaagatcaatgacttggtggagttccctgttaggaacctggacctgagc
aagttctgcattggtcagaaagaggagcagctgcccagctacgatctatatgctgtcatc
aaccactatggaggcatgattggtggccactacactgcctgtgcacgcctgcccaatgat
cgtagcagtcagcgcagtgacgtgggctggcgcttgtttgatgacagcacagtgacaacg
gtagacgagagccaggttgtgacgcgttatgcctatgtactcttctaccgccggcggaac
tctcctgtggagaggccccccagggcaggtcactctgagcaccacccagacctaggccct
gcagctgaggctgctgccagccagggactaggccctggccaggcccccgaggtggccccc
acgcggacagcccctgaacgcttcgccccccctgtggatcggccagcccccacctacagc
aacatggaggaggtggattag

DBGET integrated database retrieval system