KEGG   Pongo abelii (Sumatran orangutan): 100442074Help
Entry
100442074         CDS       T01416                                 

Gene name
ITGA8
Definition
integrin, alpha 8
Orthology
K06584  
integrin alpha 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100442074 (ITGA8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100442074 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    100442074 (ITGA8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100442074 (ITGA8)
  Cell communication
   04510 Focal adhesion
    100442074 (ITGA8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100442074 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100442074 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    100442074 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 922 aa AA seqDB search
MSTGASRGPRGSQAPLIAPLCCAAAALGMMLWSPASQAFNLDVEKLTVYSGPKGSYFGYA
VDFHIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGYVSI
INSTDMMFIQNFTGEQMASYFGYTIVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILIGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQRGKVL
IYNGNKDGLNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLHPMIINLENKTCQLPDSMTSAACFSLRVCASVTGQSIANTIVLMA
EVQLDSLKQKGAIKRTLFLENHQAHRIFPLVIKWQKSHQCQDFIVYLRDETEFRDKLSPI
NISLNYSLDESIFKEGLEVKPILNYYRENIVSEQAHILVDCGEDNLCVPDLKLSARTDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVPRLEKTNMSITRHFNLQIRSSNKDNPDSNFVSLQ
INITAVAQVEIRGVSHPPQIVLPIQNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDT
ILEVGWPFSARDEFLLYIFHIQTLGPLQCHTNPNINPQDIKIKTSVIWATPNVSFSIPLW
VIILAILLGLLVLAILTLALWK
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccggggccagccgcggtccccggggaagccaggcgccgctgatcgcgcccctc
tgctgcgccgcggcagcgctggggatgatgctgtggtcccctgcctctcaggcgttcaac
ctggacgtggaaaagctcacggtgtacagcggccccaagggcagctacttcggctacgcc
gtggacttccacatacccgacgcccgcacagcgagtgtcttggtgggggcgccgaaagcc
aacaccagccagcccgatatcgtggaagggggagccgtctattactgtccttggcccgcg
gaggggtctgcgcagtgcaggcagataccgtttgacaccaccaacaacagaaagatcaga
gttaatggaaccaaagaacctatcgagttcaaatccaatcagtggtttggagcaacagtg
aaagctcacaaaggaaaagttgtggcctgtgctcctttatatcactggagaactcttaaa
ccgacaccagaaaaggacccagttggcacctgctatgtagcaattcagaacttcagcgcc
tatgccgagttctctccttgccggaacagcaatgctgatccggaaggccagggttactgc
caagcaggatttagtctggatttttataagaatggagaccttattgtgggaggacctggg
agtttctactggcaagggcaagtgatcactgccagtgttgcagatatcattgcaaattac
tcattcaaggatatcctcaggaaattggcaggagaaaagcagacggaagtggctccagct
tcctatgatgacagttaccttggatactcagttgctgctggggagtttactggggattct
cagcaagaattggttgctggagttccaagaggagcacagaattttggatatgtttcaatc
attaactctacggatatgatgtttattcagaatttcactggcgaacagatggcatcttat
tttggatataccattgtcgtatcagatgttaacagtgacggactggatgatgtcctggtt
ggagcacctctctttatggaacgtgaatttgagagcaaccccagagaagtagggcaaatc
tacctgtatttgcaagtgagctctctcctcttcagagacccccagatcctcatcggcacc
gagacgtttgggagattcggtagtgctatggcgcacttaggagacctgaaccaagatgga
tacaatgacattgccatcggcgtgccttttgcaggcaaggatcaaagaggcaaagtgctc
atttataatgggaacaaagatggcttaaacaccaagccttcccaagttctgcaaggagtg
tgggcctcacacgctgtcccttctggatttggctttactttaagaggagattcagacata
gacaagaatgattacccagatttgattgtgggtgcatttggaacaggaaaagtcgctgtt
tacagagcaagaccggttgtgactgtagatgcccagcttctgctgcacccaatgattatc
aatcttgaaaataaaacttgccagcttccagactctatgacatctgcagcctgcttttct
ttaagagtatgtgcatctgtcacaggccagagcattgcaaacacaatagtcttgatggca
gaggtgcaattagattccctgaaacagaaaggagccattaaacggacactcttccttgaa
aaccatcaggctcatcgcatcttccctcttgttataaaatggcagaaatcccaccagtgc
caggatttcatcgtttaccttcgagatgaaactgaattccgagataaattatctccaatc
aacattagtttgaattacagtttggacgaatccatctttaaagaaggcctggaagtgaaa
ccaatattgaactactacagagaaaacattgttagtgaacaggctcacattctggtggac
tgtggagaagacaatctgtgtgttcctgacttgaagctgtcggctagaacagataagcat
caggtaatcattggagatgaaaatcaccttatgctcataataaatgcaagaaatgaaggg
gaaggagcatatgaagctgaactctttgtaatgataccagaagaggcagattatgttggg
atcgaacgcaacaacaagggatttcgaccactgagctgtgagtacaagatggaaaatgta
accaggatggtagtgtgcgaccttgggaaccctatggtgtctggaacaaattattccctg
ggcctccgatttgcagttccacgtcttgagaaaacaaacatgagcattacacggcacttc
aatctccaaatcagaagttccaacaaggacaatccagacagcaattttgtgagcctgcaa
atcaacatcactgctgtagcacaggtggaaataagaggagtgtcacaccctccgcagatt
gttctgcccattcaaaactgggaaccagaagaggagccccacaaagaggaggaggttgga
ccattggtggaacatatttatgagctgcacaatattggaccaagtaccatcagtgacacc
atcctggaggtgggctggcctttctctgcccgggatgaatttcttctctatattttccat
attcaaactctgggacctctgcagtgccacactaatcctaatatcaatccacaggatata
aagattaagacatcagttatttgggcaactccaaatgtttccttctcaatcccattatgg
gtaataatactagcaatacttcttggattgttggttctggccattttaaccttagcttta
tggaag

DBGET integrated database retrieval system