KEGG   Pongo abelii (Sumatran orangutan): 100442255Help
Entry
100442255         CDS       T01416                                 

Gene name
IRS1
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
cGMP-PKG signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100442255 (IRS1)
   04022 cGMP - PKG signaling pathway
    100442255 (IRS1)
   04151 PI3K-Akt signaling pathway
    100442255 (IRS1)
   04152 AMPK signaling pathway
    100442255 (IRS1)
   04150 mTOR signaling pathway
    100442255 (IRS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100442255 (IRS1)
   04920 Adipocytokine signaling pathway
    100442255 (IRS1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100442255 (IRS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100442255 (IRS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100442255 (IRS1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100442255 (IRS1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100442255 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2B
AA seq 1247 aa AA seqDB search
MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPN
GQYVLSRGGNGHRYTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTITHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTHSYPEEGLEMHPLERRGGHHR
PDSSTLHTDDGYMPMSPGVAPVPSSRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGGCSPDIGGGPSSSSSSSNAVPSGSSYGKLWTNGVGGHHSHVLPHPKPPVES
SSGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPENPQHKPVLSYYSLPRSFKHTQHPGEP
EEGARHQHLRLSTSSGRLLYAATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPH
LPRKVDTAAQTNSRLARPTLLSLGDPKASTLPRAREQQQQQQQQQQQPLLHPPEPKSPGE
YVNIEFGSDQPGYLSGPVASHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQ
ESTGVEMGRLGPAPPGAASICRPTRAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADM
RTGIAAEEVSLPRATMAAASSSSAASASPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRV
NLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSS
EDVKRHSSASFENVWLRPGELGGAPKEPAQLCGAAGGLENGLNYIDLDLVKDFKQRPQEC
TPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggagagcgatggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaaacgcttcttcgtactgcgcgctgccagcgaggctgggggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatcccccttgagagctgcttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgagacgagcactttgccatcgcggcggacagcgag
gccgagcaagacagctggtaccaggctctcctacagctgcacaaccgtgctaagggccac
cacgacggagctgctgccctcggtgcgggaggtggtgggggcagctgcagtggcagctcc
ggccttggtgaggctggggaggacttgagctacggtgacgtgcccccaggacccgcattc
aaagaggtctggcaggtgatcctgaagcccaagggcctgggtcagacaaagaacctgatt
ggtatctaccgcctctgcctgaccagcaagaccatcagcttcgtgaagctgaactcggag
gcagccgccgtggtgctgcagctgatgaacatcaggcgctgtggccactcggagaacttc
ttcttcatcgaggtgggccgttctgccgtgacgggtcccggggagttctggatgcaggtg
gatgactccgtggtggcccagaacatgcacgagaccatcctggaggccatgcgggccatg
agtgatgagttccgccctcgcagcaagagccagtcctcgtccaactgctctaaccccatc
agcgtccccctgcgccggcaccatctcaacaatcccccgcccagccaggtggggctgacc
cgccgatcgcgcactgagagcatcaccgccacctccccggccagcatggtgggcgggaag
ccaggctccttccgtgtccgcgcctccagtgacggcgaaggcactatgtcccgcccagcc
tcggtagacggcagccctgtgagtcccagcaccaacagaacccacgcccaccggcatcgg
ggcagcgcccggctgcaccccccgctcaaccacagccgttccatccccatgccggcttcc
cgctgctcgccttcggccaccagcccggtcagtctgtcgtccagtagcaccagtggccat
ggctccacctcggattgtctcttcccacggcgatctagtgcttcggtgtctggttccccc
agcgatggcggtttcatctcctcagatgagtatggctccagtccctgtgattttcggagt
tccttccgcagcgtcactccggattccctgggccacaccccaccagcccgcggtgaggag
gagctaagcaactatatctgcatgggtggcaaggggccctccaccctgaccgcccccaac
ggtcaatacgttttgtctcggggtggcaatggccaccgctacaccccaggaacaggcttg
ggcacgagtccagccttggctggggatgaagcagccagtgctgcagatctggataatcgg
ttccgaaagagaactcactcggcaggcacatcccctaccattacccaccagaagaccccg
tcccagtcctcagtggcttccattgaggagtatacagagatgatgcctgcctacccacca
ggaggtggcagtggaggccgactgccgggacacaggcactccgccttcgtgcccacccac
tcctacccagaggagggtctggaaatgcaccccttggagcgtcgggggggccaccaccgc
ccagacagctccaccctccacactgatgatggctacatgcccatgtccccaggggtggcc
ccagtgcccagcagccgaaagggcagtggagactatatgcccatgagtcccaagagcgtg
tctgccccacagcagatcatcaatcccatcagacgccatccccagagagtggaccccaat
ggctacatgatgatgtcccccagcggtggctgctctcctgacattggaggtggccccagc
agcagcagcagcagcagcaatgctgtcccttccgggagcagctatggaaagctgtggaca
aacggggtagggggccaccactctcatgtcttgcctcaccccaaacccccagtggagagc
agcagtggtaagctcttaccttgtacaggtgactacatgaacatgtcaccagtgggggac
tccaacaccagcagcccctccgactgctactacggccctgagaacccccagcacaagcca
gtcctctcctactactcattgccaagatcctttaagcacacccagcaccctggggagccg
gaggagggtgcccggcatcagcacctccgcctttccactagctctggtcgccttctctat
gctgcaacagcggatgattcttcctcctccaccagcagtgacagcctgggtgggggatac
tgcggggctaggctggagcccagccttccacatccccaccatcaggttctgcagccccat
ctgcctcgaaaggtggacacagctgctcagaccaatagccgcctggcccggcccacgttg
ctgtccctgggggatcccaaggccagcaccttacctcgggcccgagagcagcagcagcag
cagcagcagcagcagcagcagcccctgctgcaccctccagagcccaagagcccaggggaa
tatgtcaatattgaatttgggagtgatcagcctggctacttgtctggcccggtggcttcc
cacagctcaccttctgtcaggtgtccatcccagctccagccagctcccagagaggaagag
actggcactgaggagtacatgaagatggacctggggccgggccggagggcagcctggcag
gagagcactggggtcgagatgggcagactgggccccgcacctcccggggctgctagcatt
tgcaggcctacccgggcagtgcccagcagccggggtgactacatgaccatgcagatgagt
tgtccccgtcagagctacgtggacacctcgccagctgcccctgtaagctatgctgacatg
cggacaggcattgctgcagaggaggtgagcctgccgagggccaccatggctgctgcctcc
tcatcctcagcagcctctgcttccccgactgggcctcaaggggcagcagagctggctgcc
cactcgtccctgctggggggcccacaaggacctgggggcatgagcgccttcacccgggtg
aacctcagtcctaaccgcaaccagagtgccaaagtgatccgtgcagacccacaagggtgc
cggcggaggcatagctccgagaccttctcctcaacacccagtgccactcgggtgggcaac
acagtgccctttggagcaggggcagcagtagggggcggtggcggtagcagcagcagcagc
gaggatgtgaaacgccacagctctgcttcctttgagaatgtgtggctgaggcctggggag
cttgggggagcccccaaggagccagcccaactgtgtggggctgctgggggtttggagaat
ggtcttaactacatagacctggatttggtcaaggacttcaaacagcgccctcaggagtgc
acccctgaaccgcagcctcccccacccccaccccctcatcaacccctgggcagcggtgag
agcagctccacccgccgctcaagtgaggatttaagcgcctatgccagcatcagtttccag
aagcagccagaggaccgtcagtag

DBGET integrated database retrieval system