KEGG   Pongo abelii (Sumatran orangutan): 100442601Help
Entry
100442601         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 4B1
  KO
K07426  cytochrome P450 family 4 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100442601
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP4 family
   100442601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100442601
NCBI-ProteinID: XP_024092028
Position
1
AA seq 511 aa AA seqDB search
MVPSFLSLSFSSLGLLASGLILVLGFLKLIYLLLGRXKLAKAMDNFPGPPTHWLFGHALE
IQQTGSLDKVVSWAHQFPYAHPLWFGQYIGFLNIYEPDYAKAVYSCGDPKAPDVYDFLLQ
WIGEGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAMFTESTRIMLDKWEEKAREGKSLDI
FCDVGHMVLNTLMKCTFGRGDTGLGHRDSSXYLAVSDLTLSMQQCLVSFQYHNDFIYWLT
PHGCCFLRACQVAHDRTDQVIREQKAVLQDEKVRKKIQNRRHLDFVDILLGAWDEDDIKL
SDADLRAEVDTFMFEGHDTTTSGISWLLYCMALYPEHQHRCREEVCKILGDQDSFQWDDL
GKMTYLTMCIKESFRLYPPVPQVYRQLSKLVTFVDGWSLPAGSLISMHVYDLHXNSAVWP
DPEVFDPLRFSTENASKHHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLHFEFFLDP
SRLPIKMPQLVLCSKNGFHLHLKPLGPGSGK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccagcttcctctccctgagcttctcctccttgggcctgttggcttctgggctg
atcttggtcttaggctttctcaagctcatctacctgctgctggggaggtagaagttggct
aaggctatggacaacttcccagggcctcccacccactggctctttggacatgccctcgag
atccagcagacggggagcctggacaaagtagtgtcctgggcccaccagttcccatatgcc
cacccactctggttcggacagtacattggcttcctgaacatctatgagcctgactatgcc
aaagctgtgtacagctgtggagaccctaaggcccctgatgtgtatgacttcctcctccag
tggattggtgaaggcctgctggttcttgaggggcccaagtggttgcagcaccgcaagctg
ctcacacctggctttcattatgatgtgctgaagccctatgtggccatgttcactgagtcc
acacgtatcatgctggacaagtgggaagagaaggctcgggagggtaagtccttggacatc
ttctgcgatgtgggtcacatggtgctgaacacactcatgaagtgcacctttggaagagga
gacactggcctgggccacagggacagcagctagtaccttgcagtcagcgatctcactctg
tcgatgcagcagtgccttgtatccttccagtaccataatgacttcatctactggctcacc
ccacatggctgctgcttcctgcgagcctgccaggtggcccatgaccgtacagaccaggtc
atcagggagcagaaggcagtcctgcaggatgagaaggtgcggaagaagatccagaaccgg
aggcacctggacttcgtggacattctcctgggtgcctgggatgaagatgacatcaaactg
tcagatgcagacctccgggctgaagtggacacattcatgtttgaaggccatgacaccacc
accagtggtatctcctggttactctactgcatggccctgtaccccgagcaccagcatcgt
tgtagagaggaggtctgcaagatcctaggggaccaggactccttccagtgggatgatctg
ggcaaaatgacttatctgaccatgtgcatcaaggagagcttccgcctctacccacctgtg
ccccaggtgtaccgccagctcagcaagcttgtcacctttgtggatggctggtctctacct
gcaggaagcctgatctctatgcatgtctatgacctccatnagaacagtgctgtatggccc
gaccctgaggtctttgaccctctgcgtttttctacggagaatgcatccaaacaccatccc
tttgcctttatgcccttctctgctgggcccaggaattgcattgggcagcagtttgccatg
agtgagatgaaggtggtcacagccatgtgcttgctccactttgagttctttctggacccc
tcacggctgcccatcaagatgccccagcttgtcctgtgctccaagaatggcttccacctc
cacctgaagccactgggccctgggtctgggaagtag

DBGET integrated database retrieval system