KEGG   Pongo abelii (Sumatran orangutan): 100442601Help
Entry
100442601         CDS       T01416                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 420 aa AA seqDB search
MVPSFLSLSFSSLGLWASGLILVLGFLKLIYLLLRRXKLAKAMDNFPGPPTHWLFGHALE
IQQTGSLDKVVSWAHQFPYAHPLWFGQYIGFLNIYEPDYAKAVYSCGDPKAPDVYDFLLQ
WIGEGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAMFTESTRIMLDKWEEKAREGKSLDI
FCDVGHMVLNTLMKCTFGRGDTGLGHRDSSXYLAVSDLTLSMQQCLVSFQYHNDFIYWLT
PHGCCFLRACQVAHDRTECSSCVAGRDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKLV
TFVDGRSLPAGSLISMHVYDLHXNSAVWPDPEVFDPLRFSTENASKHHPFAFMPFSAGPR
NRIGQQFAMSEMKVVTAMCLLHFEFFLDPSRLPIKMPQLVLCSKNGFHLHLKPLGPGSGK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccagcttcctctccctgagcttctcctccttgggcctgtgggcttctgggctg
atcttggtcttaggctttctcaagctcatctacctgctgctgcggaggtagaagttggct
aaggctatggacaacttcccagggcctcccacccactggctctttggacatgccctcgag
atccagcagacggggagcctggacaaagtagtgtcctgggcccaccagttcccatatgcc
cacccactctggttcggacagtacattggcttcctgaacatctatgagcctgactatgcc
aaagctgtgtacagctgtggagaccctaaggcccctgatgtgtatgacttcctcctccag
tggattggtgaaggcctgctggttcttgaggggcccaagtggttgcagcaccgcaagctg
ctcacacctggctttcattatgatgtgctgaagccctatgtggccatgttcactgagtcc
acacgtatcatgctggacaagtgggaagagaaggctcgggagggtaagtccttggacatc
ttctgcgatgtgggtcacatggtgctgaacacactcatgaagtgcacctttggaagagga
gacactggcctgggccacagggacagcagctagtaccttgcagtcagcgatctcactctg
tcgatgcagcagtgccttgtatccttccagtaccataatgacttcatctactggctcacc
ccacatggctgctgcttcctgcgagcctgccaggtggcccatgaccgtacagaatgttct
agttgtgttgctggcagggatgatctgggcaaaatgacttatctgaccatgtgcatcaag
gagagcttccgcctctacccacctgtgccccaggtgtaccgccagctcagcaagcttgtc
acctttgtggatggccggtctctacctgcaggaagcctgatctctatgcatgtctatgac
ctccatnagaacagtgctgtatggcccgaccctgaggtctttgaccctctgcgtttttcc
acggagaatgcatccaaacaccatccctttgcctttatgcccttctctgctgggcccagg
aatcgcattgggcagcagtttgccatgagtgagatgaaggtggtcacagccatgtgcttg
ctccactttgagttctttctggacccctcacggctgcccatcaagatgccccagcttgtc
ctgtgctccaagaatggcttccacctccacctgaagccactgggccctgggtctgggaag
tag

DBGET integrated database retrieval system