KEGG   Pongo abelii (Sumatran orangutan): 100442641Help
Entry
100442641         CDS       T01416                                 

Gene name
GPX5
Definition
glutathione peroxidase 5 (epididymal androgen-related protein)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100442641 (GPX5)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100442641 (GPX5)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100442641 (GPX5)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100442641 (GPX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 221 aa AA seqDB search
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYV
GKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKVFGFLKHSCPHPSEILGTFKSISWDPVKVHDIR
WNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgactacacagttaagggtcgtccatctgcttccccttctcctagcctgctttgtgcaa
acaagtcccaagcaggagaagatgaagatggattgccacaaagatgagaaaggcaccatc
tatgactatgaggccatcgcacttaataagaacgaatacgtttccttcaagcagtatgtg
ggcaagcacatcctcttcgtcaacgtggccacctactgtggtctgacagcgcaatatcct
gaattaaatgcactccaggaggagctgaagccctatggtctagttgtgttgggctttccc
tgcaaccaatttggaaagcaagaaccaggagataacaaagagattcttcctgggctcaag
tatgtccgtccagggggaggatttgtacctaatttccagctttttgagaaaggggatgtg
aatggtgaaaaagaacagaaagtcttcggcttcttgaagcactcctgtcctcatccctct
gagattttgggcaccttcaaatctatatcctgggaccctgtaaaggtccatgacatccgt
tggaactttgaaaagttcctggtggggcccgatggaatccctgtcatgcgctggtcccac
cgggctacggtcagctcagtcaagacagacatcctggcgtacttgaagcaattcaaaacc
aaatag

DBGET integrated database retrieval system