KEGG   Pongo abelii (Sumatran orangutan): 100442853Help
Entry
100442853         CDS       T01416                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100442853 (PDK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100442853 (PDK1)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100442853 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2B
AA seq 445 aa AA seqDB search
MRLARLLRGAALAGPGPGXXXXXXPASERGVPGQVDXYARFSPXPLSMKQFLDFGSVNAC
EKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAED
AKAIYERPIRTWLQVSSLCCMACKMIFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDP
VTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVVEVIKD
GYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEH
HANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVP
LAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHY
NTNHEADDWCVPSREPKDMTTFRSA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgcggctgcttcgcggagccgccttggccggcccgggcccggggatnnnn
nnnnnnnnnnncccggcgtccgagcgcggcgttccgggccaggtggacntttacgcgcga
ttctcgccgntcccgctctccatgaagcagttcctggacttcggatcagtgaatgcttgt
gaaaagacctcatttatgtttctgcggcaagagttgcctgtcagactggcaaatataatg
aaagaaataagtctccttccagataatcttctcaggacaccatccgttcaattggtacaa
agctggtatatccagagtcttcaggagcttcttgattttaaggacaaaagtgctgaggat
gctaaagctatttatgaaaggcctataagaacatggttgcaggtctctagtttatgctgt
atggcctgtaagatgatctttacagatactgtgatacggatcagaaaccgacacaatgat
gtcattcccacaatggcccagggtgtgattgaatacaaggagagctttggggtggatcct
gtcaccagccagaatgttcagtactttttggatcgattctacatgagtcgcatttcaatt
agaatgttactcaatcagcactctttattgtttggtggaaaaggcaaaggaagtccatct
catcgaaaacacattggaagcataaatccaaactgcaatgtagttgaagttattaaagat
ggctatgaaaatgctaggcgtctgtgtgatttgtattatattaactctcccgaactagaa
cttgaagaactaaatgcaaaatcaccaggacagccaatacaagtggtttatgtaccatcc
catctctatcacatggtgtttgaacttttcaagaatgcaatgagagccactatggaacac
catgccaacagaggtgtttacccccctattcaagttcatgtcacgctgggtaatgaggat
ttgactgtgaagatgagtgaccgaggaggtggcgttcctttgaggaaaattgacagactc
ttcaactacatgtattcaactgcaccgagaccccgtgttgagacctcccgcgcggtgcct
ctggctggttttggttatggattgcccatatcacgtctttacgcacaatacttccaagga
gacctgaagctgtattccctagagggttacgggacagatgcagttatctacattaaggct
ctgtcaacagactcaatagaaagactcccagtgtataacaaagctgcctggaagcattac
aacaccaaccacgaggctgatgactggtgcgtcccaagcagagaacccaaagacatgacg
acattccgcagtgcctag

DBGET integrated database retrieval system