KEGG   Pongo abelii (Sumatran orangutan): 100442968Help
Entry
100442968         CDS       T01416                                 

Gene name
CLK2
Definition
CDC-like kinase 2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100442968 (CLK2)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100442968 (CLK2)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100442968 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 271 aa AA seqDB search
MFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTH
TDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYR
APEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKT
RKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRL
TLGEALQHPFFARLRAEPPNKLWDSSRDISR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactggtttgactaccatggccacatgtgtatctcctttgagcttctgggcctt
agcaccttcgatttcctcaaagacaacaactacctgccctaccccatccaccaagtgcgc
cacatggccttccagctgtgccaggctgtcaagttcctccatgataacaagctgacacat
acagacctcaagcctgaaaatattctgtttgtgaattcagactatgagctcacctacaac
ctagagaagaagcgagatgagcgaagtgtgaagagcacagctgtgcgggtggtagacttt
ggcagtgccacctttgaccatgagcaccatagcaccattgtctccactcgccattaccga
gcaccagaagtcatccttgagttgggctggtcgcagccttgtgatgtgtggagtataggc
tgcatcatctttgaatactatgtgggattcaccctcttccagacccatgacaacagagag
catctagccatgatggaaaggatcttgggtcctatcccttcccggatgatccgaaagaca
agaaagcagaaatatttttaccggggtcgcctggattgggatgagaacacatcagctggg
cgctatgttcgtgagaactgcaaaccgctgcggcggtatctgacctcagaggcagaggaa
caccaccagctcttcgatctgattgaaagcatgctagagtatgaaccagctaagcggctg
accttgggtgaagcccttcagcatcctttcttcgcccgccttcgggctgagccgcccaac
aagttgtgggactccagtcgggatatcagtcggtga

DBGET integrated database retrieval system