KEGG   Pongo abelii (Sumatran orangutan): 100443075Help
Entry
100443075         CDS       T01416                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100443075 (USP1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100443075 (USP1)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100443075 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 785 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPK
EEMSGINSMEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNMKKKVKVSKEHQSLEENQRQT
RSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGK
ITTNQGAKGQSKENEYDPEEDLGKCENDNTTNGCGLESPGNTVTPVNVNEVKPINKGEEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNK
KNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETNDTNGTHESDRNKESSD
QTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLL
FYKKL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagcgaaagtaatggactttcaagaggtagcccatcaaagaaa
aacagactttccttaaagttttttcagaaaaaggaaactaagagagctttggatttcaca
gattctcaagaaaatgaagaaaaagcttctgaatatagagcatctgaaattgatcaagtt
gttcctgcagcacagtcttcacctataaactgtgagaagagagaaaacttgttaccattt
gtgggactgaataatctcggcaatacttgctatcttaatagtatacttcaggtattatat
ttttgtcccggttttaaatctggagtaaagcacttatttaatattatttcaaggaagaaa
gaagctctaaaggatgaagccaatcaaaaagacaagggaaattgcaaagaagattctttg
gcaagttatgaattgatatgcagtttacagtccttaatcatttcggttgaacagctccag
gctagttttctcttaaatccagagaaatatactgatgaacttgccactcagccaaggcga
ctgcttaacacactcagggaactcaaccctatgtatgaaggatatctacagcatgatgca
caggaagtattacagtgtattttgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaagtaaaaaatgtggcagaattacctactaaggtagaagaaataccccatccgaaa
gaggaaatgagtggtattaacagcatggagatggacagtatgaggcattctgaagacttt
aaagaaaaactcccaaaaggaaatgggaaaagaaaaagtgacactgaatttggtaacatg
aagaaaaaagttaaagtatccaaggaacaccagtcattggaagagaaccagagacaaact
agatcaaaaagaaaagctacaagtgatacgttagagagtcctcctaaaataattcccaag
tatatttctgaaaatgagagtccaagaccctcacaaaagaaatcacgagttaaaataaat
tggttaaagtctgcaactaagcaacccagcattctttctaaattctgtagtctgggaaaa
ataacaacaaaccaaggagccaaaggacaatccaaagaaaatgaatatgatcctgaagag
gacttggggaagtgtgaaaatgataacacaactaatggttgtggacttgaatctccagga
aatactgttacacctgtaaatgttaatgaagttaaacccataaacaaaggtgaggaacaa
attggttttgagctagtggagaaattatttcaaggtcagctggtattaaggacgcgttgc
ttggaatgtgaaagtttaacagaaagaagagaagattttcaagacatcagtgtgccagta
caagaagatgagctttccaaagtagaggagagttctgaaatttctccagagccaaaaaca
gaaatgaagaccctgagatgggcaatttcacaatttgcttcagtagaaaggattgtagga
gaagataaatatttctgtgaaaactgccatcattatactgaagctgaacgaagtcttttg
tttgacaaaatgcctgaagttataactattcatttgaagtgctttgctgctagtggtttg
gagtttgattgttatggtggtggactttccaagatcaacactcctttattgacacctctt
aaattgtcactagaagaatggagcacaaagccaactaacgacagctatggattatttgcg
gttgtgatgcatagtggcattacaattagtagtgggcattacactgcttctgttaaagtc
actgaccttaacagtttagaactagataaaggaaattttgtggttgaccaaatgtgtgaa
ataggtaagccagaaccattgaatgaggaggaagcaaggggtgtggttgagaattacaat
gatgaagaagtgtcgattagagttggtggaaatacacagccaagtaaagttttgaacaaa
aaaaatgtagaagctattggacttcttggaggacaaaagagcaaagcagattatgagcta
tacaacaaagcctctaatcctgataaggttgctagtacagcgtttgctgaaaatagaaat
tctgagactaatgatactaatgggacccatgaatctgatagaaacaaggaatccagtgac
caaacaggcattaatattagtggatttgagaacaaaatttcatacgtagtacaaagctta
aaggagtatgaggggaagtggttgctttttgatgattctgaagtcaaagttactgaagag
aaggactttctgaattctctttccccttctacatctcctacttctactccttacttgcta
ttttataagaaattatag

DBGET integrated database retrieval system