KEGG   Pongo abelii (Sumatran orangutan): 100443394Help
Entry
100443394         CDS       T01416                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100443394 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100443394 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    100443394 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100443394 (LPL)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100443394 (LPL)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100443394 (LPL)
  Exosomal proteins of breast milk
   100443394 (LPL)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100443394 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Enzymes
  100443394 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
8
AA seq 475 aa AA seqDB search
MESKALIALALAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
TESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgatcgcgctggccctggccgtgtggctccagagtctgaccgcc
tcccgcggaggggtggccgccgccgaccaaagaagagattttatcgacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgccacctcattcctggagta
acagaatccgtggctacctgtcacttcaatcacagcagcaaaaccttcatggtgatccac
ggctggacggtaacaggaatgtatgagagttgggtgccaaaacttgtggccgccctgtac
aagagagaaccagactccaacgtcattgtggtggactggctgtcacgggctcagcagcat
tacccagtgtccgcgggctacaccaaactggtgggacaggatgtggcccggtttatcaac
tggatggaggaggagtttaactaccctctggacaatgtccatctcttgggatacagcctt
ggagcccatgctgctggcattgcaggaagtctgaccaataagaaagtcaacagaattact
ggcctcgatccagctggacctaactttgagtatgcagaagccccgagtcgcctttctcct
gatgatgcagattttgtagacgtcttacacacattcaccagagggtcccctggccgaagc
attggaatccagaaaccagttgggcatgttgacatttacccgaatggaggtacttttcag
ccaggatgtaacattggagaagctatccgtgtgattgcagagagaggccttggagatgtg
gaccagctagtgaaatgctcccatgagcgctccattcatctcttcatcgactccctgttg
aatgaagaaaatccaagtaaggcctacaggtgcagttccaaggaagcctttgagaaaggg
ctctgcttgagttgtagaaagaaccgctgcaacaatctgggctatgagatcaataaagtc
agagccaaaagaagcagcaaaatgtacctgaagactcgttctcagatgccctacaaagtc
ttccattaccaagtaaagattcatttttctgggactgagagtgaaacccataccaaccag
gcctttgagatttctctgtatggcaccgtggccgagagtgagaacatcccattcactctg
cctgaagtttcaacaaataagacatactccttcctaatttacacagaggtagatattgga
gaactactcatgttgaagctcaaatggaagagtgattcatactttagctggtcagactgg
tggagcagtcccggctttgctattcagaagatcagagtaaaagcaggagagactcagaaa
aaggtgatcttctgttctagggagaaagtgtctcatttgcagaaaggaaaggcacctgcg
gtatttgtgaaatgccatgacaagtctctgaataagaagtcaggctga

DBGET integrated database retrieval system