KEGG   Pongo abelii (Sumatran orangutan): 100443394Help
Entry
100443394         CDS       T01416                                 

Gene name
LPL
Definition
lipoprotein lipase
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pon00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:pon03320]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:pon05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 468 aa AA seqDB search
MESKALIALALAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
TESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQH
YPVSAGYTKLVGQDVARFINWMEFEHVILLDTALEAHAAGIAGSLTNKKVNRITGLDPAG
PNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIG
EAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCR
KNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKGRLETVEVAMIYLSEAPNSHCQQGPSA
QRGMCSLARCPPLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFA
IQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgatcgcgctggccctggccgtgtggctccagagtctgaccgcc
tcccgcggaggggtggccgccgccgaccaaagaagagattttatcgacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgccacctcattcctggagta
acagaatccgtggctacctgtcacttcaatcacagcagcaaaaccttcatggtgatccac
ggctggacggtaacaggaatgtatgagagttgggtgccaaaacttgtggccgccctgtac
aagagagaaccagactccaacgtcattgtggtggactggctgtcacgggctcagcagcat
tacccagtgtccgcgggctacaccaaactggtgggacaggatgtggcccggtttatcaac
tggatggagtttgaacatgtcattctcttggatacagcattggaagcccatgctgctggc
attgcaggaagtctgaccaataagaaagtcaacagaattactggcctcgatccagctgga
cctaactttgagtatgcagaagccccgagtcgcctttctcctgatgatgcagattttgta
gacgtcttacacacattcaccagagggtcccctggccgaagcattggaatccagaaacca
gttgggcatgttgacatttacccgaatggaggtacttttcagccaggatgtaacattgga
gaagctatccgtgtgattgcagagagaggccttggagatgtggaccagctagtgaaatgc
tcccatgagcgctccattcatctcttcattgactccctgttgaatgaagaaaatccaagt
aaggcctacaggtgcagttccaaggaagcctttgagaaagggctctgcttgagttgtaga
aagaaccgctgcaacaatctgggctatgagatcaataaagtcagagccaaaagaagcagc
aaaatgtacctgaagactcgttctcagatgccctacaaaggtaggctggagactgttgag
gttgcaatgatctatttgtctgaggctcctaattcccattgccagcaaggccccagtgct
cagcgtgggatgtgcagccttgctcgctgccctcccctgcctgaagtttcaacaaataag
acatactccttcctaatttacacagaggtagatattggagaactactcatgttgaagctc
aaatggaagagtgattcatactttagctggtcagactggtggagcagtcccggctttgct
attcagaagatcagagtaaaagcaggagagactcagaaaaaggtgatcttctgttctagg
gagaaagtgtctcatttgcagaaaggaaaggcacctgcggtatttgtgaaatgccatgac
aagtctctgaataagaagtcaggctga

DBGET integrated database retrieval system