KEGG   Pongo abelii (Sumatran orangutan): 100443482Help
Entry
100443482         CDS       T01416                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100443482 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100443482 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100443482 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100443482 (SCD5)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100443482 (SCD5)
Lipid biosynthesis proteins [BR:pon01004]
 Desaturase
  First
   100443482 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 256 aa AA seqDB search
MGPAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAFQNDIFEWSRDHRAH
HKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRIQRKYYKI
SVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNISWLVNSAAHMYGNRPYDKHI
SPRQNPLVALGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDFMCWLGLAADRKRAT
KPMIEARKARTGDSSA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggacccgcctacttctgcttcctcctggctgctctgggtgtgacagctggtgcccat
cgcttgtggagccacaggtcctacagggccaagctgcctctgaggatatttctggctgtc
gccaactccatggctttccagaatgacatcttcgagtggtccagggaccaccgagcccac
cacaagtactcagagacggatgctgacccccacaatgcccgccggggcttcttcttctcc
catattgggtggctgtttgtgcgcaagcatcgagatgttattgagaaggggagaaagctt
gacgtcactgacctgcttgctgatcctgttgtccggatccagagaaagtactataagatc
tccgtggtgctcatgtgctttgtggtccccacgctggtgccctggtacatctggggagag
agtctgtggaattcctacttcttggcctctattctccgctataccatctcactcaacatc
agctggctggtcaacagcgccgcccacatgtatggaaaccggccctatgacaagcacatc
agccctcggcagaacccactcgtcgctctgggtgccattggtgaaggcttccataattac
catcacacctttccctttgactactctgcgagtgaatttggcttaaattttaacccaacc
acctggttcattgatttcatgtgctggctggggctggccgctgaccgcaaacgggcaacc
aagccgatgattgaggcccggaaggccaggactggagacagcagtgcttga

DBGET integrated database retrieval system