KEGG   Pongo abelii (Sumatran orangutan): 100443482Help
Entry
100443482         CDS       T01416                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5 isoform X1
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01040  Biosynthesis of unsaturated fatty acids
pon01212  Fatty acid metabolism
pon03320  PPAR signaling pathway
pon04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100443482 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100443482 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100443482 (SCD5)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100443482 (SCD5)
Lipid biosynthesis proteins [BR:pon01004]
 Desaturase
  First
   100443482 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 100443482
NCBI-ProteinID: XP_024102027
Position
4
AA seq 330 aa AA seqDB search
MPGPATDAGKIAFCDAKEEIRAGLESSERGGGRERPGARGQRQNIVWRNVVLMSLLHLGA
VYSLVLVPKAKPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAF
QNDIFEWSRDHRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL
ADPVVRIQRKYYKISVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNISWLVNS
AAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDF
MCWLGLAADRKRATKPMIEARKARTGDSSA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccacagacgcggggaagatcgccttctgcgacgccaaggaagaaatt
cgtgcggggctcgaaagctcggagcgcggcggcggccgggagaggcccggcgcgcgcggg
cagcggcagaacatcgtttggaggaacgtggtcctgatgagcttgctccacttgggggcc
gtgtactccctggtgctcgtccccaaagccaagccactcactctgctctgggcctacttc
tgcttcctcctggctgctctgggtgtgacagctggtgcccatcgcttgtggagccacagg
tcctacagggccaagctgcctctgaggatatttctggctgtcgccaactccatggctttc
cagaatgacatcttcgagtggtccagggaccaccgagcccaccacaagtactcagagacg
gatgctgacccccacaatgcccgccggggcttcttcttctcccatattgggtggctgttt
gtgcgcaagcatcgagatgttattgagaaggggagaaagcttgacgtcactgacctgctt
gctgatcctgttgtccggatccagagaaagtactataagatctccgtggtgctcatgtgc
tttgtggtccccacgctggtgccctggtacatctggggagagagtctgtggaattcctac
ttcttggcctctattctccgctataccatctcactcaacatcagctggctggtcaacagc
gccgcccacatgtatggaaaccggccctatgacaagcacatcagccctcggcagaaccca
ctcgtcgctctgggtgccattggtgaaggcttccataattaccatcacacctttcccttt
gactactctgcgagtgaatttggcttaaattttaacccaaccacctggttcattgatttc
atgtgctggctggggctggccgctgaccgcaaacgggcaaccaagccgatgattgaggcc
cggaaggccaggactggagacagcagtgcttga

DBGET integrated database retrieval system