KEGG   Pongo abelii (Sumatran orangutan): 100443679Help
Entry
100443679         CDS       T01416                                 

Gene name
DYRK2
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 601 aa AA seqDB search
MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKLKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccaggaaaccttcggccgccgctcccgccgcctacccgaccggccgaggtggg
gacagcgccgttcgtcagcttcaggcttccccggggctcggtgcgggggccacccggagc
ggagtagggaccggcccgccctcccccatcgccctgccgcctctccgggccagcaacgct
gccgccgcagcccacacgattggcggcagtaagcacacaatgaatgatcacctgcatgtc
ggcagccacgctcacggacagatccaggttcaacagctgtttgaggataacagtaacaag
cggacagtgctcacgacacaaccaaatgggcttacaacagtgggcaaaacgggcttgcca
gtggtgccagagcggcagctggacagcattcatagacggcaggggagctccacctctcta
aagtccatggaaggcatggggaagttgaaagccactcccatgacacctgaacaagcaatg
aagcaatacatgcaaaaactcacagccttcgaacaccatgagattttcagctaccctgaa
atatatttcttgggtctaaatgctaagaagcgccagggcatgacaggtgggcccaacaat
ggtggctatgatgatgaccagggatcatatgtgcaggtgccccacgatcatgtggcttac
aggtatgaggtcctcaaggtcattgggaaggggagctttgggcaggtggtcaaggcctac
gatcacaaagtccaccagcacgttgccctaaagatggtgcggaatgagaaacgcttccac
cggcaagcagcggaggagatccgaatcctggaacacctgcggaagcaggacaaggataac
acaatgaatgtcatccatatgctggagaatttcaccttccgcaaccacatctgcatgacg
tttgagctgctgagcatgaacctctatgagctcatcaagaagaataaattccagggcttc
agcctgcctttggttcgcaaatttgcccactcgattctgcagtgcttggatgctttgcac
aaaaacagaataattcactgtgaccttaagcccgagaacattttgttaaagcagcagggt
agaagcggtattaaagtaattgattttggctccagttgttacgagcatcagcgtgtctac
acgtacatccagtcgcgtttttaccgggctccagaagtgatccttggggccaggtatggc
atgcccattgatatgtggagcctgggctgcattttagcagagctcctgacgggttacccc
ctcttgcctggggaagatgaaggggaccagctggcctgtatgattgaactgttgggcatg
ccctcgcagaaactgctggatgcatccaaacgagccaaaaattttgtgagctccaagggt
tatccccgttactgcactgtcacaactctctcagatggctctgtggtcctcaacggaggc
cgttcccggagggggaaactgaggggcccaccggagagcagagagtgggggaacgcgctg
aaggggtgtgacgatccccttttccttgacttcttaaaacagtgtttagagtgggatcct
gcagtgcgcatgaccccaggccaggctttgcggcacccctggctgaggaggcggttgcca
aagcctcccactggggagaagacgtcagtgaaaaggataactgagagcaccggtgctatc
acatctatatccaagttacctccaccttccagctcagcttccaaactgaggactaatttg
gcgcagatgacagatgccaatgggaatattcagcagaggacagtgttgccaaaactcgtt
agctga

DBGET integrated database retrieval system