KEGG   Pongo abelii (Sumatran orangutan): 100443819Help
Entry
100443819         CDS       T01416                                 

Gene name
PLCD3
Definition
phospholipase C, delta 3
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100443819 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100443819 (PLCD3)
   04070 Phosphatidylinositol signaling system
    100443819 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100443819 (PLCD3)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100443819 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 747 aa AA seqDB search
MRLLTIGEEGSPARGREAYCGAKAWVWRGWRKGQQVLAGKGRGASEQGRSDAPGPPAPAG
LTEDEDVRAMLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIE
AVREGHQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLD
AMSQRERLDHGSHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNN
DRLEGAEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEEQGEEGATLARAQQL
IQTYELNETAKQHELITLYGFMMYLLSQRGLAFAQGCRCVELDCWEGPGGEPVIYHGHTL
TSKILFRDVVQAVRDHAFTLSPYPVILSLENHCGLEQQAAMARHLRTILGDMLVTQALDF
PNPEELPSPEQLKGRVLVKGKKLPAARSEDGRALSDREEEEDDEEEEEEVEAAAQRRLAK
QISPELSALAVYCHATRLGTLHPAPNAPQPCQVSSLSERKAKKLIREAGNSFVRHNARQL
TRVYPLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPAC
LRQPDSTFDPEYPGPPRTTLSIQVLTAQQLPKLNAEKPHSIVDPLVRVEIHGVPADCARQ
ETDYVLNNGFNPRWGQTLQFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGY
RHIHLLSKDGASLSPATLFIQIRIQRS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttcttacaatcggggaggaggggagtcctgcgaggggcagggaagcttactgt
ggggcgaaggcctgggtttggagaggctggaggaaggggcagcaggtcctagcggggaag
ggcaggggagcctctgagcagggacggtctgacgccccgggtcctcccgccccggcaggc
ctgacggaggacgaggacgtgcgcgccatgctgcggggctcccggctccgcaagatccgc
tcgcgcacgtggcacaaggagcggctgtaccggctgcaggaggacggcctgagcgtgtgg
ttccagcggcgcatcccgcgtgcgccatcgcagcacatcttctttgtgcagcacatcgag
gccgtccgcgagggccaccagtccgagggcctgcggcgcttcgggggtgccttcgcgccg
gcgcgctgcctcaccatcgccttcaagggccgccgcaagaacctggacctggcggcgccc
acggctgaggaagcgcagcgctgggtgcgcggtctgaccaagctccgcgcgcgcctggac
gccatgagccagcgcgagcggctagaccatggatcccactcctatctgcaccgggctgac
tccaaccaggacagcaagatgagcttcaaggagatcaagagcctgctgagaatggtcaac
gtggacatgaatgacatgtacgcctacctcctcttcaaggagtgtgaccactccaacaac
gaccgtctagagggggctgagatcgaggagttcctgcggcggctgctgaagcggccggag
ctggaggagatcttccatcagtactcgggcgaggaccgtgtgctgagtgcgcccgagctg
ctggagttcctggaggagcagggcgaggagggcgccacactggcccgcgcccagcagctc
attcagacctacgagctcaacgaaacagccaagcagcatgagctgattacactgtatggc
ttcatgatgtacctgttgtcccagagggggctggcctttgcccagggatgccgctgcgtg
gagctggactgctgggaggggccaggaggggagcccgtcatctatcacggccataccctc
acctccaagattctcttccgggacgtggtgcaagccgtgcgcgaccatgctttcacgctg
tccccctaccctgtcatcctatccctggagaaccactgcgggctggagcagcaggctgcc
atggcccgccacctccgcaccatcctgggggacatgctggtgacacaggctctggacttc
ccaaatcccgaggagctgccgtccccagagcagctgaagggccgggtcctggtgaaggga
aagaagctgcccgctgctcggagcgaggatggccgggctctgtcggatcgggaggaggag
gaggatgacgaggaggaagaagaggaggtggaggctgcagcgcagaggcggctggccaag
cagatctccccggagctgtcggccctggccgtgtactgccacgccacccgcctgggaacc
ctgcaccctgcccccaatgccccgcaaccctgccaggtcagctccctcagcgagcgcaaa
gccaagaaactcattcgggaggcagggaacagctttgtcaggcacaatgcccgccagctg
acccgcgtgtacccgctggggctgcggatgaactcagccaactacagtccccaggagatg
tggaactcgggctgtcagctcgtggccttgaacttccagacgccaggctacgagatggac
ctcaatgccgggcgcttcctggtcaatgggcagtgtggctatgtcctaaaacctgcctgc
ctgcggcaacctgactcgacctttgaccctgagtacccgggacctcccagaaccactctc
agcatccaggtgctgactgcacagcagctgcccaagctgaatgctgagaagccacactcc
attgtggaccccctggtgcgcgttgagatccatggggtgcccgcagactgtgcccggcag
gagactgactacgtgctcaacaatggcttcaacccccgctgggggcagaccctgcagttc
cagctgcgggctccggagctggcactggtccggtttgtggtggaagattatgacgccacc
tcccccaatgactttgtgggccagtttacactgcctcttagcagcctaaagcaagggtat
cgccacatacacctgctttccaaggacggggcctcactgtcaccagccacgctcttcatc
caaatccgcatccagcgctcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system