KEGG   Pongo abelii (Sumatran orangutan): 100443853Help
Entry
100443853         CDS       T01416                                 

Gene name
TYMP
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100443853 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100443853 (TYMP)
 Human Diseases
  Cancers
   05219 Bladder cancer
    100443853 (TYMP)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100443853 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 464 aa AA seqDB search
MAASMTPGTGAPPAPGDFSGEGSQGXXAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWR
QQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQS
PEQMQVLLEQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSA
LVVDVKFGGAAVFPNQEQARELAKTLVSCGLSLGKRLDAGPAYPSPLPSPLPPCTQQSCL
SPLPPSPARSRSLLHGSPTCCDFRGPGWPGLGLGKPSVASLTQTKYKFLLAPWGACSAQR
TRGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARALCSGSPAERRQLLPRAREQ
EELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWL
RVHRDGPALSGPQRRALQKALILSDRAPFAAPSPFAELVLPPQQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcgatgactccgggaaccggggccccacccgcgccaggtgacttctctggg
gaggggagccagggannnnnggccatccgacttcggggcatggatctggaggagacctcg
gtgctgacccaggccctggcccagtcggggcagcagctggagtggccagaggcctggcgc
caacagcttgtggacaagcactccacaggcggtgtgggtgacaaggtcagcctggtcctc
gcacctgccctggcggcatgtggctgcaaggtgccaatgatcagcggacgtggtctgggg
cacacaggaggcaccttggataagctggagtctattcctggattcaatgtcatccagagc
ccagagcagatgcaagtgctgctggagcaggcgggttgctgtatcgtgggtcagagtgag
cagctggtccctgcagacggaatcctatatgcagccagagatgtgacagccaccgtggac
agcctgccactcatcacagcctccatcctcagtaagaagctcgtggagggactgtccgct
ctggtggtggacgttaagttcggaggggccgccgtcttccccaaccaggagcaggcccgg
gagctggcaaagacgctggtgagctgtggcctctccctgggcaagcgtcttgatgcgggc
ccagcctacccttcacccctcccgtccccactgcctccctgcactcagcagtcctgccta
agcccactcccaccctctcctgctcgaagtcgctccctccttcacggctccccaacctgc
tgtgactttagaggtccaggctggcccggcctgggcctggggaagccctctgtggcgtcc
ctcacccagaccaagtacaagttcctcctggccccatggggcgcctgctctgctcagcgg
acacgcgggactcaggcccagggcgctgcccgggtggccgcggcgctggacgacggctcg
gcccttggccgcttcgaacggatgctggcggcgcagggcgtggatcccggtctggcccga
gccctgtgctccggaagccccgcagagcgccggcagctgctgcctcgcgcccgggagcag
gaggagctgctggcgcccgcagatggcaccgtggagctggtccgggcgctgccgctggcg
ctggtgctgcacgagctcggggccgggcgcagccgcgctggggagccgctccgcctgggg
gtcggcgccgagctgctggtcgacgtgggtcagaggctgcgccgtgggacgccctggctc
cgcgtgcaccgggacggccccgcgctcagcggcccgcagcgccgcgccctgcagaaggcg
ctcatactctccgaccgcgcgccattcgccgccccctcgcccttcgcagagctcgttctg
ccgccgcagcaataa

DBGET integrated database retrieval system