KEGG   Pongo abelii (Sumatran orangutan): 100443916Help
Entry
100443916         CDS       T01416                                 

Gene name
USP44
Definition
(RefSeq) ubiquitin specific peptidase 44
  KO
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100443916 (USP44)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100443916 (USP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 713 aa AA seqDB search
MLAMDKCKHVGQLRLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKH
FQESSHPVALEVNEMYVFCYLCDDYVLNDNATGDLKLLRSTLSAIKSQNYHCTTRSGRFL
RSVGTSDDSYFLYDSAQSLLQNEDQMYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPF
QEKIVVKREVKKRRQELEYRVKAELESMPPRKSLRLQGLAQSTIIEIVSVQVPAQTPASP
AKDKVLSTSENERSQKVSDSSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQC
FLKLDLNQWLAMTASEKTRSSCKHPLVTDTVVYHMNECQEKDTGFVRSRQSSLSSGLSGG
ASKSRKMELIQPKEPTSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGY
AQQDAQEFLCELLDKIQRELETTGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTC
LACDNKSNTIEPFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQ
CNSKRRRFSSKPVVLTEAQKQLMICHLPQVLRLHLKRFRWSGHNNREKIGVHVGFEEILN
MEPYCCRETLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSM
CTMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPNEDTDTSSNEILS
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgctagcaatggataagtgcaaacatgttgggcagctgcggcttgctcaagaccattcc
agcctcaaccctcagaaatggcactgtgtggactgcaatacgaccgagtccatttgggct
tgccttagctgctcccatgttgcctgtggaagatacattgaagagcatgcactcaagcac
tttcaagaaagcagtcatcctgttgcattggaggtgaatgagatgtatgttttttgctac
ctttgtgatgattatgttctgaatgataatgcaactggagacctgaagttactacgaagt
acattaagtgccatcaaaagtcaaaattatcactgcacaactcgtagtgggaggttttta
cggtccgtgggtacaagtgatgattcttatttcttatatgacagtgcccaatctctgctt
caaaatgaagatcaaatgtatactgctctttggcacaggagaaggatactaatgggtaaa
atctttcgaacatggtttgaacaatcacccattggaagaaaaaagcaagaagaaccattt
caggaaaaaatagtagtaaaaagagaagtaaagaaaagacggcaagaattggagtatcga
gttaaagcagaattggaaagtatgcctccaagaaagagcttacgtttacaagggctcgct
cagtcgaccataatagaaatagtttctgttcaggtgccagcacaaacgccagcatcacca
gcaaaagataaagtactctctacctcagaaaatgaaagatctcaaaaagtcagtgactcc
tcagttaaacgaaggccaatagtaactcctggtgtaacaggattgagaaatttgggaaat
acttgctatatgaattctgttcttcaggtgttgagtcatttacttatttttcgacaatgt
tttttaaagcttgatctgaaccaatggctggctatgactgctagcgagaagacaagatct
tcttgtaagcatccactagtcacagatacagtagtatatcacatgaatgaatgtcaggaa
aaagatacaggttttgttcgctccagacaatcaagtctgtcatcaggactaagtggtgga
gcatcaaaaagtagaaagatggaacttattcagccaaaggagccaacctcacagtacatt
tctctttgtcatgaattgcatactttgttccaagtcatgtggtctggaaagtgggcgttg
gtctcaccatttgctatgctacactcagtgtggagactcattcctgcctttcgtggttac
gcccaacaagacgctcaggaatttctttgtgaacttttagataaaatacaacgtgaatta
gagacaactggtaccagtttaccagctcttatccccacttctcaaaggaaactcatcaaa
caagttctgaatgttgtaaataacatttttcatggacaacttcttagtcaggttacatgt
cttgcatgtgacaacaaatcaaataccatagaacctttctgggacttgtcattggagttt
ccagaaagatatcaatgcagtggaaaagatattgcttcccagccatgtctggttactgaa
atgttggccaaatttacagaaactgaagctttagaaggaaaaatctacgtatgtgaccag
tgtaactcaaagcgtagaaggttttcctccaaaccagttgtactcacagaagcccagaaa
caacttatgatatgccacctacctcaggttctcagactgcacctcaaacgattcaggtgg
tcaggacataataaccgagagaagattggtgttcatgttggctttgaggaaatcttaaac
atggagccctattgctgcagggagaccctgaaatccctcagaccagaatgctttatctat
gacttgtccgcggtggtgatgcaccatgggaaaggatttggctcagggcactacactgcc
tactgctataattctgaaggagggttctgggtacactgcaatgattccaaactgagcatg
tgcactatggatgaagtatgcaaggctcaagcgtatatcctgttttatacccaacgagtt
actgagaatggacattctaaacttttgcctccagagctcctgttggggagccaacatccc
aatgaagacactgatacctcatctaatgaaatccttagctga

DBGET integrated database retrieval system