KEGG   Pongo abelii (Sumatran orangutan): 100444145Help
Entry
100444145         CDS       T01416                                 

Gene name
PLCE1
Definition
phospholipase C, epsilon 1
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100444145 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100444145 (PLCE1)
   04015 Rap1 signaling pathway
    100444145 (PLCE1)
   04020 Calcium signaling pathway
    100444145 (PLCE1)
   04070 Phosphatidylinositol signaling system
    100444145 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100444145 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100444145 (PLCE1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100444145 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 2303 aa AA seqDB search
MTSEEMTASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRRSGETSNTISLLNKL
KEEPSGSNLPKILSIAREKIVSDENSNEKCWDKIMPDSVKNLNINCNNILRNHQHGLSQR
QFCEMYNSVAEEDLCLETGIPSPLERKVFPGIQLELDRPSMGISPLRNQSAIIETDRAHP
DSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPVGEEKQKKKYVAYTCKLMEL
AKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSSDSFCRKDFTDSQAAKTFLSHF
EDFPDNCEDIEEDAFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLTA
WSYIDQKRNGPLLPCGRVTEPPSTVEIRQGGSRRLSEAQWYPIYNAVRRGEETENTVGSL
LHFLTKLPASETAHGRISVGPCLKQCVRDTVCEYRTTLQRTSISQYITGSLLEATTSLGA
RSGLLSTFGGSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASIL
MEQEQSIYRRVLPVDYLCFLTRDLGTPECQRSLPCLKASVSASIVTTQNGEHNALEDLVM
RFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKM
WQFMDQSDIESMMSLKVAMALLVSYCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDG
ASGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCSR
SLETDEEDSPSEGNSSRKSSFKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAF
DHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTA
SPASTKAKLGVLNNTAEPGKFPLLGNAGLSGLTEGVLDLFAVKAVYMGHPGIDIHTVCVH
NKLGSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQR
QQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTAAKNAEKPNMQRNNTL
GISTTKKKKKILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEANAIAN
PPNPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGG
MKGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLT
IDENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSL
GIFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKEN
FASKNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELD
CWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAE
IFKTVFGEKLVAKFLFETDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQL
ASMQVQAYNGGNANPPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEY
NEEIPKRIKKADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPG
LSTLNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPL
NPTTSLSAIIRTPKCYHISSLNENATKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNP
NPLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPL
ERDLDNMDPAVYSLTIVSGQNVCPSNSTGSPCIEVDILGMPLDSCHFRTKPIHRNTLNPM
WNEQFLFRVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEIS
SLFINSRRMEENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGDTKAK
QLLQQILTTEQDIKPVATDYFLMEEKYFISKEKNECRKQPFQRAIGPEEDIMQILSSWFP
EEGYVGRIVLKTQQKNLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVS
TAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEELVKDTTNKKTTTPKSSQRVLLDQECVF
QAQSKWKGAGKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSE
SIQTKEEKPVGGLSSSDTMDYRQ
NT seq 6912 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgaagaaatgacagcttctgttctcatacctgtgactcagagaaaagtggtt
tctgcccagtcggctgcagatgaaagtagtgaaaaggtctcagacatcaatatttcaaaa
gcacatactgtcagacgaagtggggagacgtctaataccatctcactactgaacaaactt
aaagaagaaccttctggaagcaacttgccaaagattctctcaatagcaagggagaaaata
gtgagtgatgagaacagtaatgaaaaatgctgggataaaatcatgccagattctgtgaaa
aaccttaacattaactgcaacaacatattgagaaaccatcagcatggcctttctcagaga
cagttttgtgaaatgtacaactctgttgctgaggaagacttgtgtttagaaactggaatt
ccttctccactggaaagaaaggtgttccctggaattcaactggaactagacagaccttcc
atgggcattagtcctttaagaaatcagtcagcgatcatagagacagacagagcacaccct
gacagcagaagggcagtatttcattttcattatgaagttgacagaagaatgtcagacact
ttctgtaccctatcagaaaacttaattttagacgactgtggaaattgtgtaccactacct
gtgggtgaggagaagcaaaagaaaaagtatgtggcatatacctgtaaactgatggaattg
gccaaaaattgtgataataagaatgagcagctgcagtgtgatcattgtgacaccttgaat
gataaatacttttgctttgaaggctcttgcgagaaggttgacatggtatattcaagtgat
agcttttgtaggaaagactttactgacagtcaagctgccaagacctttttgagccatttt
gaggacttccctgataattgtgaagatatagaagaagatgcttttaaaagcaaaaaggag
cgatccactttgttagtcaggagattctgtaaaaatgacagagaagttaagaaatctgtg
tatactggaacaagagcaattgtgagaactctgccttctggccacattgggctgactgca
tggagttacatagatcagaagagaaatggtcccttactgccttgtgggagagtaacagaa
cccccctcaacagtggagataaggcaaggtgggagccgacgtctgtcagaagcccagtgg
tatcctatctacaatgcagtgagaagaggagaagaaacagaaaatacagttggatctcta
ctccatttcctcaccaagctcccagcctccgagacagcccatggaaggataagcgttggc
ccatgcttaaagcaatgtgtccgagacactgtatgtgagtatcgcaccaccctccaaagg
acttcaatatcgcagtacatcaccggttctctcctagaagcaaccacatctttgggagca
agaagtggccttctcagtacttttggaggatccactggacgaatgatgctgaaagaacgc
cagccaggcccctctgtggccaattccaatgccctcccttcaagttccgctgggatcagc
aaggaactgattgatctgcagcctctcatccagttcccagaggaagtcgccagcatcctg
atggagcaggagcagagtatttaccgcagggtcttgccagtcgactacctttgcttctta
acacgggacttgggcactcctgaatgccagaggtccttgccctgcctcaaagcatccgtc
tcagcgtcgattgttaccactcagaatggagagcacaatgcccttgaagatctggtgatg
aggtttaatgaggtgagctcctgggtgacatggctgatcctcacggcaggctccatggag
gagaagagagaagtcttttcgtatttggtgcatgtggccaaatgctgctggaacatgggc
aactacaacgctgtcatggagttcttggctggcctcaggtcaagaaaagttttaaaaatg
tggcagttcatggaccagtctgatattgagtccatgatgagcttgaaggttgctatggcc
ctgcttgtgtcctattgtgagtacagaaaggtggtgacacgtgccctgcacatccctggc
tgtaaggtggttccgttctgtggggtgtttctgaaggagctctgtgaagtgcttgacggc
gcctctggcctcatgaagctttgcccgcggtacaattcccaagaagaaactttagagttt
gtagcagattacagtggacaagataatttcttacaacgagtgggacaaaatggcttaaag
aattcagagaaggagtccactgtcaacagcatctttcaggtcatccggagctgcagtcga
agtctggagacagacgaggaggacagccccagtgaaggaaacagctccaggaaaagctcc
ttcaaggataaaagccgatggcagtttataattggagatttgttggattcagacaatgac
atctttgagcaatccaaagaatacgactctcatggttcagaggattcacagaaggccttc
gaccatgggacggagctcatcccttggtacgtgctgtccatccaagctgatgtgcaccag
ttcctgctgcagggggccacggtcatccactatgaccaggacacacacctctctgcccgc
tgcttcctccagcttcagcccgacaatagcaccttgacctgggtaaagcccacaactgcc
tccccagccagcactaaagcaaaacttggtgtacttaataacacagctgagcctggaaaa
ttcccactactgggcaatgctggattaagtggcctgacggaaggggtcttggatcttttt
gcagtgaaggctgtatacatgggccaccctggcattgatatacacactgtgtgtgttcac
aacaaactgggtagcatgttcctgtcagagactggtgtgacactgctctatgggcttcag
accacggacaacagattattgcacttcgtggcaccgaagcacacagctaaaatgctcttc
agtggattattggaactcactagagctgtgagaaagatgaggaaattccctgaccaaaga
cagcagtggctgcggaaacagtacgtcagcctctatcaggaggatggacggtatgaaggc
ccaactttggctcatgctgtggagttgtttggtggcagacggtggagtgctcgaaacccc
agccccggaacagctgcaaagaatgctgagaagcccaatatgcagagaaacaacaccctg
ggcataagcactaccaagaaaaagaagaaaatcctcatgaggggtgagagtggagaggtg
actgacgatgagatggcaacccgaaaggccaagatgcacaaagagtgtcgaagccggagt
ggttctgatcctcaagacattaatgaacaagaagaatcagaggcgaatgccatcgctaac
cctccaaaccccctcccttccagaagagcccactctttgaccacagctgggtcccccaac
ttggctgccgggacatcatctcccatcaggccagtgtcctcccctgtgctgtcttcttca
aacaagagcccatccagtgcttggagcagtagtagctggcacgggcggatcaaaggcggc
atgaagggatttcagagcttcatggtttcagatagcaacatgagttttgttgaatttgtt
gagctgttcaaatcgttcagtgtcaggagccgcaaggacctgaaggatctgtttgatgtc
tatgcagtgccctgcaaccgatctggctccgagtcagccccactctacaccaacctgaca
attgatgaaaacaccagcgatcttcagcctgacctagatctgttgaccagaaatgtctcg
gatttggggttgttcattaagagtaaacagcagctatcggacaaccagaggcagatatct
gatgccattgctgctgcaagcattgtgacaaatggcactgggattgagagcacatctctg
ggtattttcggggtgggcatacttcagctcaacgatttcctcgtgaattgccaaggagaa
cactgcacttatgatgaaatcctcagcatcatccagaagtttgagcctagcatcagtatg
tgtcatcagggactaatgtcatttgaagggtttgcaaggtttctgatggataaagaaaat
tttgcctcaaaaaatgatgagtcacaggagaacattaaagaactgcagctacccctctca
tattattacatcgaatcttcgcacaatacctacctcacgggccatcagctcaaaggagaa
tcctcagtagaactctacagccaggtcctcttgcaaggctgtcgaagtgtagaattggac
tgctgggacggagacgatgggatgcccatcatttatcatggacatacgctgacaaccaag
atccccttcaaggaagtggttgaagccattgatcgcagtgccttcatcaactctgacctg
ccaatcatcatatcgattgagaaccactgttcattgcctcagcaacgaaaaatggcagaa
attttcaagactgtgtttggagaaaagctggtggctaaattcttatttgagactgatttc
tcagatgatccaatgcttccttcacctgaccaactcagaaggaaagttcttcttaaaaac
aagaagctaaaagcccatcagacgccagtggatatcttaaagcaaaaggctcatcagtta
gcatctatgcaagtgcaggcttataatggtgggaatgccaaccccccacctgccaataat
gaggaagaggaagatgaggaggacgaatatgattatgactatgaatccctttctgatgac
aacattctggaagacagacctgaaaataaatcatgtaatgacaagcttcagtttgaatat
aatgaagaaatcccaaagaggataaagaaagcagataactctgcttgcaacaaaggaaag
gtttatgatatggaactgggagaagaattttaccttgatcagaataaaaaggaaagcaga
cagattgcaccagagctttctgaccttgtaatctattgccaagcagtaaaatttccagga
ctgtcaactctaaatgcatctggctctagcagaggaaaagaaaggaaaagcaggaagtcc
atttttggcaacaatccgggcagaatgagcccaggggagacagcatcatttaacaaaaca
tctggaaaaagttcctgtgaaggcattcgacagacctgggaggaatcttcttcccctctc
aacccaaccacgtccctcagtgctatcattagaactcccaaatgttatcatatctcgtcg
ctgaatgaaaatgccaccaaacgtctgtgtcgcaggtattctcagaaactgatccagcac
accgcctgtcagctgctgagaacttaccctgctgccacccgcatcgactcttccaacccg
aaccccctcatgttctggctccatgggatacagctcgtggcactcaactaccagaccgat
gatctccctttacatttaaatgctgcaatgtttgaggcaaatggtggttgtggttatgtt
ttgaaacctccagttctgtgggacaagaactgccccatgtatcagaagttttctccactg
gaaagagatctggacaacatggatcctgcagtctattctttaactattgtctctggtcag
aatgtgtgccccagtaacagcacaggaagcccgtgcattgaagtcgacatcctgggcatg
cctctggacagctgccatttccgcacgaagcccatccatcgaaacaccctgaaccccatg
tggaacgagcagtttctgttccgcgttcacttcgaagatcttgtatttcttcgttttgca
gttgtggaaaacaatagttcagcggtaactgctcagagaatcattccactgaaagcttta
aaacgaggatatcgacatcttcagctgcgaaaccttcacaatgaagtcttggagatttct
agtttattcattaacagcagaaggatggaagaaaattcctctggcaataccatgtcagcc
tcttcgatgtttaatacagaagaaagaaaatgtttgcagactcacagagtcacggtgcat
ggggtaccagggccagagccctttaccgttttcactattaatggagacaccaaggcaaag
cagcttctgcagcaaattctgacaactgaacaagacatcaaacctgtagccacagactat
tttttgatggaagaaaaatattttatatctaaagaaaagaatgaatgtaggaaacaacca
ttccagagagccattggtccagaagaggatatcatgcaaattttaagcagctggtttcca
gaagagggatacgtgggcaggattgtcttaaaaacccagcagaaaaacctagaagagaaa
aacattgttcaagatgacaaagaggtgatcttgagctcagaggaggagagtttctttgtc
caagtgcatgatgtttctccagagcaacctcgaacagtcatcaaagcaccccgcgtcagc
actgcacaggatgtcattcagcagaccttatgcaaagccaaatattcctacagcatcctg
agcaaccccaatccaagcgactatgtgcttttggaagagttggtgaaagacactaccaac
aagaagactaccacaccaaagtcctctcagcgggtccttctggatcaggagtgtgtgttt
caagcccaaagcaagtggaaaggtgcaggaaaattcatccttaagctaaaggagcaggtg
caggcatctcgagaagataaaaagaaaggcatttcttttgcaagtgaactcaagaagctc
accaagtcaactaaacagccccgaggacttacatcaccttctcagctcttgacctcagaa
agtatccaaaccaaggaggagaaacctgtgggtggcttgtcctccagtgacacaatggat
taccgacagtga

DBGET integrated database retrieval system