KEGG   Pongo abelii (Sumatran orangutan): 100444341Help
Entry
100444341         CDS       T01416                                 

Gene name
SRD5A1
Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 1 isoform X1
  KO
K12343  3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100444341 (SRD5A1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100444341 (SRD5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-GeneID: 100444341
NCBI-ProteinID: XP_024102842
Ensembl: ENSPPYG00000015333
Position
5
AA seq 259 aa AA seqDB search
MATATGVAEERLLAALAYLQCAAGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggcgacgggggtggcggaggagcgcctgctggccgcgctcgcctacctgcag
tgcgccgcgggctgcgcggtcttcgcgcggaatcgtcagacgaactcggtgtacggccgc
cacgcgctgcccagccacaggctccgagtgccggcgcgggccgcctgggtggtgcaggag
ctgccctcgctggccctgccgctctaccagtacgccagcgagtccgccccgcgcctccgc
agcgcgcccaactgcatcctcctggccatgttcctcgtccactacgggcatcggtgctta
atttacccatttctgatgcgaggaggaaagcctatgccactgttggcatgtacaatggcg
attatgttctgtacctgtaacggctatttgcaaagcagatacttgagccattgtgcagtg
tatgctgatgactgggtaacagatccccgttttctaataggttttggcttgtggttaacg
ggcatgttgataaacatccattcagatcatatcctaaggaatctcagaaaaccaggagat
actggatacaaaataccaaggggaggcttatttgaatacgtaactgcagccaactatttt
ggagaaatcatggagtggtgtggctatgccctggccagctggtctgtccaaggcgcagct
tttgctttcttcacgttttgttttttatctggtagagcaaaagagcatcatgagtggtac
ctccggaaatttgaagagtatccaaagttcagaaaaattataattccatttttgttttaa

DBGET integrated database retrieval system