KEGG   Pongo abelii (Sumatran orangutan): 100444354Help
Entry
100444354         CDS       T01416                                 

Gene name
GLA
Definition
galactosidase, alpha
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pon00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pon00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pon00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:pon00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:pon04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 430 aa AA seqDB search
MQLRNPELHLGCVLALRFLALVSWDIPRARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQL
ANYVHNKGLKLGIYADVGKXNPAQASPGSFGYYDIDAQTFADWGVDLPKFDGCYCDSLEN
LADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSI
KSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSND
LRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWQRPLSDLAWAVAMINRQEI
GGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLRLEN
TMQMSLKDLL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaggaacccagagctgcatctgggctgcgtgcttgcccttcgcttcctggcc
ctcgtttcctgggacatccctagggctagagcactggacaatggattggcaaggacgcct
accatgggctggctgcactgggagcgcttcatgtgcaaccttgactgccaggaagagcca
gattcctgcatcagtgagaagctcttcatggagatggcagagctcatggtctcagaaggc
tggaaggatgcaggttatgagtacctctgcattgatgactgttggatggctccccaaaga
gattcagaaggcagacttcaggcagaccctcagcgctttcctcatgggattcgccagcta
gctaattatgttcacaacaaaggactgaagctagggatttatgcagatgttggaaaataa
aaccctgcgcaggcttcccctgggagttttggatactacgacattgatgcccagaccttt
gctgactggggagtagatctgcctaaattcgatggttgttactgtgacagtttggaaaat
ttggcagatggttataagcacatgtccttggccctgaataggactggcagaagcattgtg
tactcctgtgagtggcctctttatatgtggccctttcaaaagcccaattatacagaaatc
cgacagtactgcaatcactggcgaaattttgctgacattgatgattcctggaaaagtata
aagagtatcttggactggacatcttttaaccaggagagaattgttgatgttgctggacca
gggggttggaatgacccagatatgttagtgattggcaactttggcctcagctggaatcag
caagtaactcagatggccctctgggctatcatggccgctcctttattcatgtctaatgac
ctccgacacatcagccctcaagccaaagctctccttcaggataaggacgtaattgccatc
aatcaggaccccttgggcaagcaagggtaccagcttagacagggagacaactttgaagtg
tggcaacgacctctctcagacttagcctgggctgtagctatgataaaccggcaggagatt
ggtggacctcgctcttataccatcgcagttgcttccctgggtaaaggagtggcctgtaat
cctgcctgcttcatcacacagctcctccctgtgaaaaggaagctagggttctatgaatgg
acttcaaggttaagaagtcacataaatcccacaggcactgttttgcttcggctagaaaat
acaatgcagatgtcattaaaagacttactttaa

DBGET integrated database retrieval system