KEGG   Pongo abelii (Sumatran orangutan): 100444573Help
Entry
100444573         CDS       T01416                                 

Definition
UDP-glucuronosyltransferase 2B30-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100444573
   00053 Ascorbate and aldarate metabolism
    100444573
   00500 Starch and sucrose metabolism
    100444573
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100444573
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100444573
   00860 Porphyrin and chlorophyll metabolism
    100444573
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100444573
   00982 Drug metabolism - cytochrome P450
    100444573
   00983 Drug metabolism - other enzymes
    100444573
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100444573
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100444573
Glycosyltransferases [BR:pon01003]
 Others
  Hydrophobic molecule
   100444573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 560 aa AA seqDB search
MTTVAFISKKTIIQIAQETFSRLRAVCEGNAIKVSEKWVFTILLPQLCCAGCGFCEKVLV
WPTEFSHWMNIKTILDELVQRGHEVTVLAYSTSILPDPNNPSALKFEVSPTSLTETEFED
SITQLVKRWSDVPKDTFWPHFLQVQEMMWSYSDMIRKFCEDVVSNKKLMKKLQESRFDVV
LADAVSPCGELLAELLKIPFVYSLRFSPGYAIEKHGGGLLFPPSYVPVVMSELSDQMTFM
ERVKNMIYVLYFDFWFQIWDMRKWDQFYSKVLGRPTTLFETMAKAEIWLIRNYWDFQFPH
PVLPNVELVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNTSEERANVIATAL
AKIPQKVLWRFDGNKPDTLGLNTQLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGI
PMVGVPLFADQLDNVAHMKAKGAAVSLDFNTMSSTDLLNALKTVINDPLYKENAMKLSRI
HHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLACVAAVIFII
TKCLFCVWKFVRTGKKGKRD
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagttgcctttattagtaagaagaccatcattcaaattgcacaagaaacattc
tccaggctgagagcagtgtgtgagggaaatgccatcaaggtgtctgagaagtgggttttc
acaattctgttacctcagctctgctgtgctggctgtggattctgtgagaaggtgctggtg
tggcccacagaattcagccattggatgaatataaagacaatcctggatgaacttgtccag
agaggtcatgaggtgactgtattggcatattcaacttccattcttcctgatcccaacaac
ccatctgctcttaaatttgaagtttctcctacatctttaactgaaactgagtttgaggat
agcatcacgcaattggttaagagatggtcagatgttccaaaagacacattttggccacat
tttttacaagtacaagaaatgatgtggtcatatagtgacatgattagaaaattctgtgaa
gatgtggtttcaaataagaaacttatgaagaaactacaggagtcaagatttgatgttgtt
cttgcagatgctgtttccccctgtggtgagctgctggctgagctacttaaaatacccttt
gtctacagcctccgtttctctcctggctacgcaattgaaaagcatggtggaggacttctg
ttccctccttcctatgtgcctgttgttatgtcagaattaagtgatcaaatgactttcatg
gagagggtaaaaaatatgatctatgtgctttattttgacttttggttccaaatatgggat
atgaggaagtgggatcagttttacagtaaagttctaggaagacccactacattattcgag
acaatggcaaaagctgaaatatggcttattcgaaactactgggattttcaatttcctcac
ccagtcttaccaaatgttgagttggttgggggactccactgcaaacctgccaaaccccta
cctaaggaaatggaagagtttgtccaaagctctggagaaaatggtgttgtggtgttttct
ctggggtcaatggtcagtaacacatcagaagaaagggccaatgtaattgcaacagccctt
gccaagatcccacaaaaggttctgtggagatttgatggcaataaaccagataccttagga
ctcaatactcagctttataagtggataccccagaatgatcttcttggtcacccaaaaacc
agagcttttataactcatggtggagccaatggcatctacgaggcgatctaccatggaatc
cctatggttggcgttccattgtttgcagatcaacttgataacgttgcacacatgaaggcc
aagggcgcagctgttagtttggacttcaacacaatgtcgagtacagacttactcaacgca
ctgaagacagtaattaatgatcctttatataaagagaatgctatgaaattatcaagaatt
catcatgatcagccagtaaagcccctggatcgagcagtcttctggattgaatttgtcatg
cgccataaaggagccaagcaccttcgggttgcagctcacgacctcacctggttccagtat
cactctttggatgtgattgggttcctcctggcctgtgtggcagctgtgatattcatcatc
acaaaatgtctgttttgtgtctggaagtttgttagaacaggaaagaagggaaaaagagat
taa

DBGET integrated database retrieval system