KEGG   Pongo abelii (Sumatran orangutan): 100445135Help
Entry
100445135         CDS       T01416                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100445135 (ARG2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    100445135 (ARG2)
   00330 Arginine and proline metabolism
    100445135 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100445135 (ARG2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100445135 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 355 aa AA seqDB search
MMSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLS
SLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGD
HSLAIGTISEHARHCPDLCVVWVDGHADINTPLTTSSGNLHGXKVSFLLRELQDKVPQLP
GFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLI
GKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNP
QLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccctaaggggcagcctctcgcgcctactccagacgcgagtgcattccatcctg
aagaaatccgtccactccgtggctgtgataggagccccgttctcacaagggcagaaaaga
aaaggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctcc
agtttgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagat
gatctctacaacaacctgatagtgaatccacgctcagtgggtcttgccaaccaggaactg
gctgaggtggttagcagagctgtgtcggatggctacagctgtgtcacactgggaggagac
cacagcctggcaatcggtaccattagtgaacatgcccgacactgcccagacctttgcgtt
gtctgggttgatggccatgctgacatcaacacaccccttaccacttcatcaggaaatctc
catggcnataaagtttcatttctcctcagagaactacaggataaggtaccacaactccca
ggattttcctggatcaaaccttgtatctcttctgcaagtattgtgtatattggtctgaga
gacgtggaccctcctgaacattttattttaaagaactatgatatccagtatttttccatg
agagatattgatcgacttggtatccagaaggtcatggaacaaacatttgatctgctgatt
ggcaagagacaaagaccaatccatctgagttttgatattgatgcatttgaccctacactg
gctccagccacaggaactcctgttgtagggggactaacctatcgagaaggcatgtatatt
gctgaggaaatacacaatacagggttgctatcagcactggatcttgttgaagtcaatcct
cagttggccacctcagaggaagaggcgaagactacagctaacctggcagtggatgtgatt
gcttcaagttttggtcagacaagagaaggagggcatattgtctatgaccaacttcctact
cccagttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system