KEGG   Pongo abelii (Sumatran orangutan): 100445135Help
Entry
100445135         CDS       T01416                                 

Gene name
ARG2
Definition
arginase, type II
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100445135 (ARG2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100445135 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100445135 (ARG2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100445135 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 355 aa AA seqDB search
MMSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLS
SLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGD
HSLAIGTISEHARHCPDLCVVWVDGHADINTPLTTSSGNLHGXKVSFLLRELQDKVPQLP
GFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLI
GKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNP
QLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccctaaggggcagcctctcgcgcctactccagacgcgagtgcattccatcctg
aagaaatccgtccactccgtggctgtgataggagccccgttctcacaagggcagaaaaga
aaaggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctcc
agtttgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagat
gatctctacaacaacctgatagtgaatccacgctcagtgggtcttgccaaccaggaactg
gctgaggtggttagcagagctgtgtcggatggctacagctgtgtcacactgggaggagac
cacagcctggcaatcggtaccattagtgaacatgcccgacactgcccagacctttgcgtt
gtctgggttgatggccatgctgacatcaacacaccccttaccacttcatcaggaaatctc
catggcnataaagtttcatttctcctcagagaactacaggataaggtaccacaactccca
ggattttcctggatcaaaccttgtatctcttctgcaagtattgtgtatattggtctgaga
gacgtggaccctcctgaacattttattttaaagaactatgatatccagtatttttccatg
agagatattgatcgacttggtatccagaaggtcatggaacaaacatttgatctgctgatt
ggcaagagacaaagaccaatccatctgagttttgatattgatgcatttgaccctacactg
gctccagccacaggaactcctgttgtagggggactaacctatcgagaaggcatgtatatt
gctgaggaaatacacaatacagggttgctatcagcactggatcttgttgaagtcaatcct
cagttggccacctcagaggaagaggcgaagactacagctaacctggcagtggatgtgatt
gcttcaagttttggtcagacaagagaaggagggcatattgtctatgaccaacttcctact
cccagttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system