KEGG   Pongo abelii (Sumatran orangutan): 100445305Help
Entry
100445305         CDS       T01416                                 

Gene name
CHKB
Definition
choline kinase beta
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pon00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 395 aa AA seqDB search
MAAEGTAVAGSGVVGGCLAKDGLQQFKCPDTTPKRRRASSLSRDAERRAYQWCQEYLGGA
WRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMP
FTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH
NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP
TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLAEVSWYALASHFFWGLWSILQ
ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaggggacagctgtggccggaagcggggttgttggcggctgcctggccaaa
gacggcttgcagcagtttaagtgcccggacactaccccaaaacggcggcgcgcctcgtcg
ctgtcgcgtgacgccgagcgccgagcctaccaatggtgccaggagtacttgggcggggcc
tggcgccgagtgcagcccgaggagctgagggtttaccccgtgagcggaggcctcagcaac
ctgctcttccgctgctcgctcccggaccacctgcccagcgttggcgaggagccccgggag
gtgctgctgcggctgtacggagccatcctgcagggcgtggactccctggtgctagaaagc
gtgatgtttgccatccttgcggagcggtcgctggggccccagctgtacggagtcttccca
gagggccggctggaacagtacatcccaagccggccattgaaaactcaagagcttcgagag
ccagtgttgtcagcagccattgccacgaagatggcgcaatttcatggcatggagatgcct
ttcaccaaggagccccactggctgtttgggaccatggagcggtacctaaaacagatccag
gacctgcccccaactggcctccctgaaatgaacctgctggagatgtacagcctgaaggat
gagatgggcaacctcaggaagttactagagtctaccccatcgccagtcgtcttctgccac
aatgacatccaggaagggaacatcttgctgctctcagagccagaaaatgctgacagcctc
atgctggtggacttcgagtacagcagttataactataggggctttgacattgggaaccat
ttttgtgagtgggtttatgattatactcacgaggaatggcctttctacaaagcaaggccc
acagactaccccactcaagaacagcagctgcattttattcgccattacctggcagaggca
aagaaaggtgagaccctctcccaagaggagcagagaaaactggaagaagatttgttggca
gaagtcagttggtatgctctggcatcccatttcttctggggtctgtggtccatcctccag
gcatccatgtccaccatagaatttggttacttggactatgcccagtctcggttccagttc
tacttccagcagaaggggcagctgaccagtgtccactcctcatcctga

DBGET integrated database retrieval system