KEGG   Pongo abelii (Sumatran orangutan): 100445423Help
Entry
100445423         CDS       T01416                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B4-like
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100445423
   00053 Ascorbate and aldarate metabolism
    100445423
   00500 Starch and sucrose metabolism
    100445423
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100445423
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100445423
   00860 Porphyrin and chlorophyll metabolism
    100445423
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100445423
   00982 Drug metabolism - cytochrome P450
    100445423
   00983 Drug metabolism - other enzymes
    100445423
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100445423
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100445423
Glycosyltransferases [BR:pon01003]
 Others
  Hydrophobic molecule
   100445423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 529 aa AA seqDB search
MSTKWTSVFLLIQLSCYIISGSCGKVLVWPTEFSHWMNMKTILEELVQRGHEVTVLASSA
SILFDPNSPSTLKLEVYPVSLTKTEFEDIFMQLVKRWADLPKDTFWSYFSQVQEIMWTFN
DIIRKFCKDAISNKKLMKKLQESKFDVVLADAIIPCGELLAELFNIPFVYSLRFSAGYTI
EKHSGGFLFPPSYVPVVMSELSDQMTFMERVKNMIYVVYFQFWFQIFNMKKWDQFYSEVL
RRPTTLSETMGKADIWLIRNSWDFQFPHPLLPNVAFVGGLHCKPAKPLPKEMEEFVQSSG
QNGVVVFSLGSMFSNMTEERANVIASALAKIPQKVLWRFDGNKPHTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGSNGIYEAIYHGIPVVGIPLLADQPDNIAHMKAKGAAIRLDFNTM
SSTDLLNALKTVINDPLYKENAIKLSRIYHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKCCMFCFLKFARTGKKGKRD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgaaatggacttcagtttttctcctgatacagctgagctgttatattatctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccattggatgaatatgaag
acaatcctggaggagcttgtccagaggggtcatgaggtgactgtattggcatcttcagct
tccattctttttgatccaaacagcccatctactcttaaacttgaagtttatcctgtatct
ttaactaaaactgagtttgaggatatcttcatgcaactggtcaagagatgggcagacctt
ccaaaagacacattttggtcatatttttcacaagtacaagaaatcatgtggacatttaat
gacataattagaaagttctgtaaggatgcaatttcaaataagaaacttatgaaaaaacta
caagagtcaaaatttgatgttgttcttgcagacgctattattccctgtggggaactgctg
gctgagctatttaacataccctttgtgtacagtctccgtttctctgctggctacacaatt
gaaaagcatagtggaggatttctgtttccaccttcctatgtacctgttgttatgtcagaa
ctaagtgaccaaatgactttcatggagagggtaaaaaatatgatctatgtggtttatttt
caattttggttccaaatatttaatatgaagaagtgggatcagttttacagtgaagttcta
agaagacccactaccttatctgagacaatggggaaagctgacatatggcttattcgaaac
tcctgggattttcagtttcctcatccactcttaccaaatgttgcttttgttggaggactc
cactgcaaacctgccaaacccctccctaaggaaatggaagagtttgtccagagctctgga
caaaatggtgttgtggtgttttcactggggtcaatgttcagtaacatgacagaagaaagg
gctaatgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccacatactttaggactcaatactcggttgtacaagtggataccccagaat
gaccttcttggtcatccaaaaaccagggcttttataactcatggtggatccaatggcatc
tacgaggcgatctaccatgggatccctgtggtgggcattccattgttagcggatcaacct
gataacattgcacacatgaaggccaagggagcagctattagactggacttcaacacaatg
tcgagtacagacttgctcaatgcactgaagacagtaattaatgaccctttatataaagag
aacgctataaagttatcaagaatttatcatgatcagccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaagcaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcctgt
gtggcaactgtgatatttatcatcacaaagtgttgtatgttttgtttcttgaaatttgct
agaactggaaagaagggaaaaagagattag

DBGET integrated database retrieval system