KEGG   Pongo abelii (Sumatran orangutan): 100445432Help
Entry
100445432         CDS       T01416                                 

Definition
ubiquitin carboxyl-terminal hydrolase 16-like
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 393 aa AA seqDB search
RVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSIPSFVDRIFGGELTSMIMCDQCRTVSL
VHESFLDLSLPVLDDQSGKKSVNDKNLKKTMEDEDQDSEEEKDNDSYMKERSDIPSGTSK
HLQKKAKKTSQKNQRRQQKIQGKVLHLNDICTIDHPEDSEYEAEMSLQGEVNIKSNHISQ
EGVMHKEYCINQKDLNGQAKMIESVTDNQKSTEEVDMKNINMDNDLVVLPSPTDCTRNLN
GAYLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHTPGTKVYEVVNEDPETAFC
TLANREVFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPKANIKGERKHVYT
NAKKQMLISLAPPVLTLHLKRFQQVLLVTQNLF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
agagtgagtaaaggaatacttaaagcatttggtaattctactgaaaaattggatgaagaa
ctaaaaaataaagttaaagattatgagaagaaaaaatcaataccaagttttgttgaccgc
atctttggtggtgaactaactagtatgatcatgtgtgatcaatgcagaactgtctccttg
gttcatgaatctttccttgatttgtccctcccagttttggatgatcagagcggtaagaaa
agtgtaaatgataaaaatctgaaaaagacaatggaggatgaagatcaagatagcgaggaa
gaaaaagataatgacagttacatgaaagagagaagtgatattccttctggaacaagtaag
cacttacagaaaaaagcaaagaaaacaagccaaaaaaaccaacgaagacaacaaaaaatt
caaggaaaagttcttcatttaaatgatatttgtactattgaccatcctgaagacagtgaa
tatgaagctgaaatgtcacttcaaggagaagtaaatattaaatccaaccatatttcacaa
gagggtgttatgcataaagaatattgtatcaaccagaaagatttgaatggccaagcaaaa
atgatcgaaagtgtaactgacaatcaaaaatccacagaggaagtagatatgaaaaatatc
aacatggataatgatctggtggttttaccatctcccactgactgtactaggaatttaaat
ggtgcctacctaacggaagggagcaatggagaagtggacatttccaatggtttcaaaaac
ctaaatttgaatgctgctcttcatcctgatgaaataaatatagagattctgaatgatagt
catactcctggaacaaaggtgtatgaggttgtaaatgaagatccagaaactgctttctgt
actcttgcaaacagggaagttttcaatactgatgagtgttcaatccaacattgtttatat
cagttcacccgtaatgagaaacttcgagatgcgaataaactgctttgtgaagtatgcaca
aggagacagtgtaatggaccaaaggcaaatataaaaggtgaaaggaagcatgtttacacc
aatgccaaaaagcagatgctaatttctcttgctcctcctgttcttactcttcatttaaag
agatttcagcaggtactccttgttacccaaaatttgttttaa

DBGET integrated database retrieval system