KEGG   Pongo abelii (Sumatran orangutan): 100445432Help
Entry
100445432         CDS       T01416                                 

Definition
ubiquitin carboxyl-terminal hydrolase 16-like
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100445432
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100445432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 345 aa AA seqDB search
MIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTMEDEDQDSEEEKDNDSYM
KERSDIPSGTSKHLQKKAKKTSQKNQRRQQKIQGKVLHLNDICTIDHPEDSEYEAEMSLQ
GEVNIKSNHISQEGVMHKEYCINQKDLNGQAKMIESVTDNQKSTEEVDMKNINMDNDLVV
LPSPTDCTRNLNGAYLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHTPGTKVY
EVVNEDPETAFCTLANREVFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPK
ANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQVLLVTQNLF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgtgtgatcaatgcagaactgtctccttggttcatgaatctttccttgatttg
tccctcccagttttggatgatcagagcggtaagaaaagtgtaaatgataaaaatctgaaa
aagacaatggaggatgaagatcaagatagcgaggaagaaaaagataatgacagttacatg
aaagagagaagtgatattccttctggaacaagtaagcacttacagaaaaaagcaaagaaa
acaagccaaaaaaaccaacgaagacaacaaaaaattcaaggaaaagttcttcatttaaat
gatatttgtactattgaccatcctgaagacagtgaatatgaagctgaaatgtcacttcaa
ggagaagtaaatattaaatccaaccatatttcacaagagggtgttatgcataaagaatat
tgtatcaaccagaaagatttgaatggccaagcaaaaatgatcgaaagtgtaactgacaat
caaaaatccacagaggaagtagatatgaaaaatatcaacatggataatgatctggtggtt
ttaccatctcccactgactgtactaggaatttaaatggtgcctacctaacggaagggagc
aatggagaagtggacatttccaatggtttcaaaaacctaaatttgaatgctgctcttcat
cctgatgaaataaatatagagattctgaatgatagtcatactcctggaacaaaggtgtat
gaggttgtaaatgaagatccagaaactgctttctgtactcttgcaaacagggaagttttc
aatactgatgagtgttcaatccaacattgtttatatcagttcacccgtaatgagaaactt
cgagatgcgaataaactgctttgtgaagtatgcacaaggagacagtgtaatggaccaaag
gcaaatataaaaggtgaaaggaagcatgtttacaccaatgccaaaaagcagatgctaatt
tctcttgctcctcctgttcttactcttcatttaaagagatttcagcaggtactccttgtt
acccaaaatttgttttaa

DBGET integrated database retrieval system