KEGG   Pongo abelii (Sumatran orangutan): 100445721Help
Entry
100445721         CDS       T01416                                 

Gene name
TESK1
Definition
(RefSeq) testis-specific kinase 1
  KO
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100445721 (TESK1)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   100445721 (TESK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 561 aa AA seqDB search
MIGYFAEAGGGASGRTGSVWYGECTESSVCVRTQAPRRLKEASCSPSSGLRGQTVFLRGG
RNPHTEEGWPTLLSSPSSCRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWSVRLR
LALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGARKEP
LAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAF
RTLVGDDCPLPFLLLAIHCCSLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTAQIHNQG
SVPRGGPSATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKL
LDTPSKPVLPLVPPSPFPSTQLPLVTTPETLVQPGTPARRCRSLPSSPELPRRMETALPG
PGPPPVGPSAERRWECEGQQPPTCPLDQTRPHNNPQLWCDSPQGWAGNPGPAQHSCPXAA
ALERTEPSPXPTAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLL
CHRGHHAKPPTPSLQLPGARS
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgattggctatttcgccgaggccggaggaggagccagcggcagaaccggaagcgtctgg
tacggcgagtgcacggagtcctcagtctgcgtgcgcacacaggcaccgcgccgacttaaa
gaggccagttgcagcccctcctccggcctgagggggcagacagtgttcctacgtggaggg
cggaaccctcacactgaggagggctggcctacccttctatcttccccatcctcttgcagg
ttcatgggggtctgtgtgcaccagggacagctgcacgctcttacagagtatatgaatggg
gggacattggaacagctgctcagctcccctgaacccctatcctggtcggtcaggctccgc
ctggccctggacattgcccgaggcctgcggtacctgcactccaaaggtgtatttcaccgc
gacctcacatccaagaactgtctagtccgacgggaagatcgaggcttcaccgctgtcgtg
ggtgacttcgggctggctgaaaagattcctgtgtatagggagggggcaaggaaggagcca
ttggccgtggtgggctccccgtactggatggctccagaggtgttacggggtgagctgtat
gatgagaaggctgatgtctttgccttcgggattgtcctctgtgagctcatcgcccgagta
cctgcagaccctgactacctaccacgcactgaggactttggcctggatgtgcctgctttc
cgaactctggtgggggatgactgcccactgcctttcctgcttctggccatccactgctgc
agcctggaacccagcacccgtgcccccttcaccgaaattacccagcacctggaatggatc
ctggagcagctgcctgaaccagccccactcaccaggactgcgcagatacacaatcagggc
tctgttccaagagggggtccctctgccacgcttcccaggccagacccccggctttcccga
agccggtcagacctcttcctgcccccatcaccagaatcaccccccaactggggggacaat
ctgactcgagtcaaccccttctcactacgggaagacctcaggggtggcaagatcaagctc
ttggacacacccagcaagccagtcctgcctcttgtgccaccatcaccattcccatccact
cagctgcccttggtgaccactccggagaccctggtccagcctggaacacctgcccgccgc
tgccgctcactaccctcatcccctgagctcccccgccgtatggagacagcactgccaggt
cctggccctccccccgtgggcccctcggctgagagacgatgggagtgcgagggtcagcag
cccccaacctgtcccttagatcagacccgtcctcataacaatccccagctgtggtgtgac
tccccacaaggctgggctgggaaccctggaccggcccagcatagctgcccgnnggcggca
gccctggagcggacagaaccctcgccannccccacagctccccgggagcccgatgagggg
ctgccctgtcctggctgctgcctcggccccttcagctttggcttcctgtccatgtgcccc
cgccccacaccagctgttgcccgctaccgcaacctgaactgtgaggcgggcagtctcctc
tgccaccgagggcaccacgccaagccacccacacccagcctgcagctgcctggggcacgc
tcttag

DBGET integrated database retrieval system