KEGG   Pongo abelii (Sumatran orangutan): 100445768Help
Entry
100445768         CDS       T01416                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 381 aa AA seqDB search
MRGLVVFLAVFALSEVNAITRVPLHKRKSLRRALKECRLLEDFLRNHHYAVSRKWTTSGV
VASKSLTNYLDVSVLSVFSVRTPPQEFTVVFDKDSLDLWVPSVYCNSDACXNHQCFDPSK
SSTXQNMGKSLSIQYGTGSMXGLLGCDTVTVSNIVDPHQTVGLSTQEPGDIFTYSEFDGI
LGLAYPSLASEXSVPMFDNMMQRHLVAQDLFSVYMSRNDQGSMLTLGAIDLSYYTGSLHW
IPMTXQEYQXFTVDSVIIDGVVVACDGGCQAILDTGTSLLVGPGSNILNIQQDATAGQYN
EFDINCGRLSSMPTVVFEIYGQKYPLPPSAYSSQIXDQGFCTSGFQGDYSSQQWILGDVF
IREYYSVFDRANNCVGLAKAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggggccttgtggtgttccttgcagtctttgctctctctgaggtcaatgccatcacc
agggttcctctgcacaaaaggaagtcgctgaggagggccctgaaggagtgcaggctcctg
gaggacttcctgaggaatcaccattacgcagtcagcaggaagtggaccacttctggagtg
gtggccagcaagtctctgaccaactacctggatgtgagtgtgctgtctgtcttcagtgtc
aggacccctccccaggagttcaccgtggtgtttgataaggactccttggatctctgggtg
ccctctgtctactgcaacagtgatgcctgttaaaaccaccaatgcttcgatccgtccaag
tcctccaccncacagaacatgggcaagtccctgtccatccagtatggcacaggcagcatg
ncaggcttgctgggctgtgacactgtcaccgtctccaacattgtggacccccaccagact
gtgggcctgagcacccaggaacctggcgacatcttcacctactccgagtttgatgggatc
ctggggctggcctatccctctcttgcctctgagtagtcagtgcccatgtttgacaacatg
atgcagaggcacctggtggcccaagacctgttctcagtctacatgagcaggaatgaccag
gggagcatgctcacgctgggggccattgacctgtcctactacacaggctccctgcactgg
atacccatgactnngcaagaataccaatagttcactgtggacagtgtcatcattgatggc
gtggtggtggcctgtgacggtggctgtcaggccatcctggacaccggcacctccctgctg
gtggggcctggcagcaacatcctcaacatccagcaggatgccaccgcaggccagtacaat
gagtttgacatcaactgcgggcgcctgagcagcatgcccacggttgtcttcgagatctac
ggccagaagtaccccctgccaccctccgcctacagcagccagatatgagaccagggcttc
tgcaccagtggtttccagggtgactatagttcccagcagtggatcctgggggatgtcttc
atccgggagtattacagtgtctttgacagggccaataactgtgtggggctggcgaaggct
gtctga

DBGET integrated database retrieval system