KEGG   Pongo abelii (Sumatran orangutan): 100446370Help
Entry
100446370         CDS       T01416                                 

Definition
cytochrome P450 2C18-like
Orthology
K17720  
cytochrome P450, family 2, subfamily C, polypeptide 18 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Retinol metabolism
Serotonergic synapse
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100446370
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100446370
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100446370
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100446370
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP2 family
   100446370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 493 aa AA seqDB search
MPMMTLAEEKPSVDPAVALVLCLSCLFLLSLWRQSSGRGRLLSGPTPLPIIGNILQLDVK
DMSKSLSNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPLAEKVNK
GLGILFSNGKRWKEIRHFSLMTLRNFGMGKRSIEDRVQEEALCLVEELRKTNGAARSFMI
VSGCWSSYGGWRFEAESQGRFCAPMLVVFVHNDYAYGVCNNFPALIDYLPGSHNKVAENF
AYIKSYVLERIKEHQESLDMNNARDFIDCFLIKMEQEKHNQQSEFTVENLIATVTDMFGA
GTETTSTTLRFGLLLLLKDPEVSAKVQEEIERVVGRNRSPCMQDRSHMPYTDAVVHEIQR
YIDLIPTNLPHAVTCDVKFRNYLIPKGMTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSG
NFKKSDYFMPFSAGKWMCVGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFG
RVPPLYQLCFIPV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgatgacattagcagaagagaagccttcagtggatccagctgtggctctggtg
ctctgtctctcctgtttgtttctcctttcactctggagacagagctctggaagagggagg
ctcctgtctggccccactcctctcccaattattggaaatatcctgcagttagatgttaag
gacatgagcaaatccttaagcaatttctcaaaagtctatggccctgtgttcactgtgtat
tttggcctgaagcccattgtggtgttgcatggatatgaagcagtgaaggaggccctgatt
gatcatggagaggagttttctggaagaggaagttttccattggctgaaaaagttaacaaa
ggacttggaatccttttcagcaatggaaagagatggaaggagatccggcatttctccctc
atgactctgcggaattttgggatggggaagaggagcatcgaggaccgtgttcaagaggaa
gccctctgccttgtggaggagttgagaaaaaccaatggggcggccagatctttcatgata
gtcagtggttgttggtcctcatacggaggttggaggtttgaagcagagagccaagggagg
ttttgtgcacctatgcttgttgtgtttgtacacaatgactatgcatacggtgtctgcaat
aatttccctgctctcatcgattatctcccaggaagtcataataaagtagctgaaaatttt
gcttacattaaaagttatgtattggagagaataaaagaacatcaagaatccctggacatg
aacaatgctcgggactttattgattgtttcctgatcaaaatggaacaggaaaagcacaat
caacagtctgaatttactgttgaaaacttgatagccactgtaactgatatgtttggggct
ggaacagagacaacgagcaccaccctaagatttggactcctgctcctgctgaaggaccca
gaggtatcagctaaagtccaggaagagattgaacgtgtagttggcagaaaccggagcccc
tgtatgcaggacaggagtcacatgccctacacagatgctgtggtgcacgagatccagaga
tacatcgacctcatccccaccaacctgccccatgcagtgacctgtgatgttaaattcaga
aactacctcatccccaagggcatgaccataataacatccctgacttctgtgctgcacaat
gacaaagaattccccaacccagagatgtttgaccctggccactttctggataagagtggc
aactttaagaaaagtgactacttcatgcctttctcagcaggaaaatggatgtgtgtggga
gagggcctggcccgcatggagctgtttttattcctgaccaccattttgcagaactttaac
ctgaaatctcaggttgacccaaaggatattgacatcacccccattgccaatgcatttggt
cgtgtgccacccttgtaccagctctgcttcattcctgtctga

DBGET integrated database retrieval system