KEGG   Pongo abelii (Sumatran orangutan): 100446490Help
Entry
100446490         CDS       T01416                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100446490 (GTF3C4)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100446490 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 817 aa AA seqDB search
MNTADQARVGPADDGPAPSGEEEGEGGGEAGGKEPAADAAPGPSAAFRLMVTRREPAVKL
QYAVSGLEPLAWSEDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKV
GSKTEVAECKEKFAASKDPTVSQTFMLDRVFNPEGKALPPMRGFKYTSWSPMGCDANGRC
LLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYRLSKNEAPEGNLGDFAEFQ
RRHSMQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVGKESI
SSCNTIESGITSPSVLFWWEYEHNNRKMSGLIVGSAFGPIKILPVNLKAVKGYFTLRQPV
ILWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTG
LHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGI
AVSPCGAYLAIITTEGMINGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFKQVDLI
DLVRWKILKDKHIPQFLQEALEKKIESSGVTYFWRFKLFLLRILYQSMQKTPSEALWKPT
HEDSKILLVDSPGMGNADDEQQEEGTSSKQVAKQGLQERSKEGEGEEKKDDSLPTTGDAG
GREPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDE
EYDDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSC
QSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPLPFL
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggccgaccaggcccgggtggggcccgcggacgacgggcctgcgccgtccggg
gaggaggagggagaggggggcggcgaggcgggcgggaaggagccagcagcggacgcggcc
ccggggcccagcgctgcattccgcctcatggtgactcggcgggagccggccgtgaagctg
cagtatgcggtgagcggcctggaaccgctggcttggtccgaggaccaccgcgtgtctgtg
tccacggcccgcagcatcgctgtgctggagcttatctgcgacgtgcacaacccgggccag
gacctggttatccaccgcacctcggtgcccgccccgctcaacagctgtctcctcaaagtt
ggctcaaaaacagaagttgctgagtgcaaggagaaattcgccgcctccaaggaccccacg
gtcagtcagactttcatgttggatagggtgttcaaccctgaggggaaggctttaccacca
atgagaggattcaagtacaccagctggtctcccatgggttgcgatgctaatggcaggtgc
ctcttggcagcactgaccatggacaatcgcctgaccatccaggcaaatctcaacagactg
cagtgggtccagctggtcgacctgactgagatctatggagaacgtctttatgagaccagt
tacaggctctctaaaaatgaggccccggaaggaaatctcggggattttgctgagtttcag
aggagacacagcatgcagaccccagtcagaatggagtggtcgggcatctgtaccacccag
caggtcaagcataacaacgaatgccgggacgttggcagtgtgctcctggctgtcctcttt
gaaaacggtaatatcgccgtgtggcagtttcagctgccgtttgtaggaaaagaatccatc
tcttcatgcaacacgattgagtcaggaatcacctctcccagtgtattgttttggtgggaa
tatgagcacaataatcgaaaaatgagtggccttattgtggggagtgcttttggacccata
aaaattcttcctgtcaatctcaaagcagtcaaaggctatttcactttaaggcagcctgtt
atcttgtggaaagaaatggaccagttacctgtgcacagcatcaaatgtgtgccactttat
catccttaccagaagtgtagttgcagcttagtcgtggctgcaagaggctcttatgtattt
tggtgtcttcttctgatctccaaagcagggctgaatgttcacaattcccatgtcacaggc
cttcactcactgccgattgtctccatgactgcagacaaacagaatggaacagtctatact
tgctccagtgatggaaaggtgaggcagctgattcccattttcacagatgttgcattgaag
tttgaacaccagttgattaaactctcagatgtgtttggctcagtgaggactcacgggata
gcagtgagcccctgcggtgcgtacctggccatcattaccactgagggcatgatcaacggc
ctccaccctgttaacaagaactaccaggtccagtttgttactctcaaaacctttgaagag
gcagctgctcagctcctggaatcttcagttcaaaacctttttaagcaggtcgatttaata
gacctagtacgctggaagattttaaaagataaacatatccctcaatttttacaagaagct
ttggaaaaaaagattgaaagcagtggagtcacctatttttggcgttttaagcttttcctc
ctgaggattttatatcagtcaatgcagaaaaccccttcagaagccttgtggaaacccacc
catgaggactcaaaaatcctactagtggattcgcctgggatgggcaatgctgacgatgaa
cagcaggaagaaggcacttcttccaaacaggtggcgaagcaaggcttgcaggagaggagc
aaggaaggggagggagaggagaaaaaagatgactcgctccccacaactggagatgctgga
ggccgtgagccaatggaagagaaactcctggaaatccaagggaaaatcgaagctgtggag
atgcacttgaccagggaacacatgaagcgagtcttaggagaagtgtatctgcacacctgg
atcacagaaaacactagcatccccacccgtggactctgtaactttttaatgtctgatgaa
gagtatgatgacagaactgcacgggtgctgattggacatatctcaaagaagatgaacaaa
cagactttccctgagcactgtagtttgtgtaaagagatcttgccattcacagatcgcaaa
caggcagtctgttccaatggccacatttggctccggtgcttcttaacctaccagtcctgc
cagagtttgatatatagaaggtgtttgctccatgacagcattgcccggcatccagctcca
gaagatcccgactggattaagaggttactgcaaagccccctgccctttctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system