KEGG   Pongo abelii (Sumatran orangutan): 100446540Help
Entry
100446540         CDS       T01416                                 

Gene name
G6PC
Definition
glucose-6-phosphatase, catalytic subunit
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100446540 (G6PC)
   00052 Galactose metabolism
    100446540 (G6PC)
   00500 Starch and sucrose metabolism
    100446540 (G6PC)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100446540 (G6PC)
   04151 PI3K-Akt signaling pathway
    100446540 (G6PC)
   04152 AMPK signaling pathway
    100446540 (G6PC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100446540 (G6PC)
   04920 Adipocytokine signaling pathway
    100446540 (G6PC)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100446540 (G6PC)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100446540 (G6PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 235 aa AA seqDB search
MRMEEGMNVLHDFGIQSTHYLQVNYEDSQDWFILVSAIADLRNAFYVLFPIWFHLQEAVG
IKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSG
HAMGTAGVYYVMVTSTLSIFRGKKKPTYRFRHSFFHSGIAVAETFSHIHSIYNASLKKYF
LITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCERPEWVHIDTKAFASLLKNL
NT seq 706 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggaggaaggaatgaatgttctccatgactttgggatccagtcaacacattac
ctccaggtgaattacgaagactcccaggactggttcatcttggtgtccgcgatagcagac
ctcaggaatgccttctacgtcctcttccccatctggttccatcttcaggaagctgtgggc
attaaactcctctgggtagctgtgattggagactggctcaacctcgtctttaagtggatt
ctctttggacagcgtccatactggtgggttttggataccgactactacagcaacacttcc
gtgcccctgataaagcagttccctgtaacctgtgagactggaccagggagcccctctggc
catgccatgggtacagcaggtgtatactacgtgatggtcacgtctactctttccatcttt
cggggaaagaaaaagccgacctacagatttcgtcattctttcttccattcaggcattgct
gttgcagaaactttcagccacatccacagcatctataatgccagcctcaagaaatatttc
ctcattaccttcttcctgttcagctttgccatcggattttatctgctgctcaagggactg
ggtgtggacctcctgtggactctggagaaagcccagaggtggtgcgagcggccagaatgg
gtccacattgacaccaaggcctttgccagcctcctcaagaacctgg

DBGET integrated database retrieval system