KEGG   Pongo abelii (Sumatran orangutan): 100446999Help
Entry
100446999         CDS       T01416                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05020  Prion diseases
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100446999 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100446999 (LAMC1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100446999 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100446999 (LAMC1)
   05222 Small cell lung cancer
    100446999 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    100446999 (LAMC1)
  Infectious diseases
   05165 Human papillomavirus infection
    100446999 (LAMC1)
   05146 Amoebiasis
    100446999 (LAMC1)
   05145 Toxoplasmosis
    100446999 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B PurA
Motif
Other DBs
NCBI-GeneID: 100446999
NCBI-ProteinID: XP_009238479
Position
1
AA seq 1608 aa AA seqDB search
MRGSHRAAPAVRPRGRLWPVLAVLAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRST
GHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNVETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRVEQRDGSEASLEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQLLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEAADYPWRPALTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSPC
VLCACNGHSETCDPETGVCNCRDNTAGLHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSC
AVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNPYGTVKQQSSCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGIT
GQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDECEENYFY
NRSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAERE
VMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVENT
ERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQVKNISQDLEKQAARVHEEAKRAG
DKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEHLIDQKLKDYEDLKEDMRGKELEV
KNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDNK
TAAEEALRKIPAINQTIIEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNAT
STKAEAERTFAEVTDLDNEVNSMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEI
NARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDL
ENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
NT seq 4827 nt NT seq  +upstreamnt  +downstreamnt
atgagggggagccatcgggccgcgccggccgtgcgaccccgggggcggctctggcccgtg
ctggccgtgctggcggccgccgcggcgggctgtgcccaggcagccatggacgagtgcacg
gacgagggcgggcggccgcagcgctgcatgcccgagttcgtcaacgccgccttcaacgtg
actgtggtggccaccaacacgtgtgggactccgcccgaggaatactgtgtgcagaccggg
gtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcagcac
ggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccag
accatgctggccggggtgcagtaccccagctccatcaacctcacgctgcacctgggaaaa
gcttttgacatcacctatgtgcgtctcaagttccacaccagccgcccagagagctttgcc
atttacaagcgcacaagggaagatgggccctggattccttaccagtactacagtggttcc
tgcgagaacacctactccaaggcaaaccgcggcttcatcaggacaggaggggacgagcag
caggccttgtgtactgatgaattcagtgacatttctcccctcactgggggcaatgtggcc
ttttctaccctggaaggaaggcccagcgcctataactttgacaatagccctgtgctgcag
gaatgggtaactgccactgacatcagagtaactcttaatcgcctgaacacttttggagat
gaagtgtttaacgatcccaaagttctcaagtcctattattatgcgatctctgattttgct
gtgggtggcagatgtaaatgtaatggacatgcaagcgagtgtatgaagaacgaatttgat
aagctggtgtgtaattgcaaacataacacatatggagtagactgtgaaaagtgtcttcct
ttcttcaatgaccggccgtggaggagggcaactgcagaaagtgccagtgaatgcctgccc
tgtgactgcaatggtcgatcccaggaatgctacttcgatcctgaactctatcgttccact
ggccatgggggccactgtaccaactgccaggataacacagatggcgcccactgtgagagg
tgccgggagaacttcttccgccttggaaacaatgaagcctgctctccatgccactgtagt
cctgtgggctctctaagcacacagtgtgatagttatggcagatgcagctgtaagccagga
gtgatgggggacaaatgtgaccgttgccagcctggattccattctctcactgaagcagga
tgcaggccatgctcttgtgatccctctggcagcatagatgaatgtaatgttgaaacagga
agatgtgtttgcaaagacaatgtcgaaggcttcaattgtgaaagatgcaaacctggattt
tttaatctggaatcatctaatcctcggggttgcacaccctgcttctgctttgggcattct
tctgtctgtacaaatgctgttggctacagtgtttattctatctcctctacctttcagatt
gatgaggatgggtggcgtgtggaacagagagatggctctgaagcatctctcgagtggtcc
tctgagaggcaagatatcgctgtgatctcagacagctactttcctcggtacttcattgct
cctgcaaagttcttgggcaagcagttgttgagttatggtcagaacctctccttctccttt
cgagtggacaggcgcgatactcgcctctctgcagaagaccttgtgcttgagggagctggc
ttaagagtatcggtacccttgatcgctcagggcaattcctatccaagtgagaccactgtg
aagtatgtcttcaggctccatgaagcagcagattacccttggaggcctgctcttacccct
tttgaatttcagaagctcctaaacaacttgacctctatcaagatccgtgggacatacagt
gagagaagtgctggatatttggatgatgtcaccctggcaagtgctcgtcctgggcctgga
gttcctgcaacttgggtggagtcctgcacctgtcctgtgggatatggagggcagttttgt
gagatgtgtctctcaggttacagaagagaaactcctaatcttggaccatacagtccatgt
gtgctttgcgcctgcaatggacacagcgagacctgtgatcctgagacaggtgtttgtaac
tgcagagacaatacagctggcctgcactgtgagaagtgcagtgatgggtactatggagat
tcaactgcaggcacctcctccgattgccaaccctgtccgtgtcctggaggttcaagttgt
gctgttgtccccaagacaaaggaggtggtgtgcaccaactgtcctactggcaccactggt
aagagatgtgagctctgtgatgatggctactttggagaccccctgggtagaaacggccct
gtgagactttgccgtctgtgccagtgcaatgacaacatcgatcccaacgcagttggaaat
tgcaatcgcttgacaggagaatgcctgaagtgcatctataacactgctggcttctattgt
gaccggtgcaaagacggattttttggaaatcctctggctcccaatccagcagacaaatgc
aaagcctgcaattgcaatccatatgggacagtgaagcagcagagcagctgtaaccccgtg
acggggcaatgtgaatgtttgcctcacgtgactggccgggactgtggtgcctgtgaccct
ggattctacaatctgcagagtgggcaaggctgtgaaaggtgtgactgccatgccttgggc
tccaccaatgggcagtgtgacatccgcaccggccagtgtgagtgccagcccggcatcacc
ggtcagcactgtgagcgctgtgaggtcaaccactttgggtttggacctgaaggctgcaaa
ccctgtgactgtcatcccgagggatctctttcacttcagtgcaaagatgatggtcgctgt
gaatgcagagaaggctttgtgggaaatcgctgtgacgagtgtgaagaaaactatttctac
aatcggtcttggcctggctgccaggaatgtccagcttgttaccggctggtaaaggataag
gttgctgatcatagagtgaagctccaggaattagagagtcttatagcaaaccttggaact
ggggatgagatggtgacagatcaagccttcgaggatagactaaaggaagcagagagggaa
gttatggacctccttcgtgaggcccaggatgtcaaagatgttgaccagaatttgatggat
cgcctacagagagtgaataacactctgtccagccaaattagccgtttacagaatatccgg
aataccattgaagagactggaaacttggctgaacaagcacgtgcccatgtagagaacaca
gagcggttgattgaaatcgcatccagagaacttgagaaagcaaaagtcgctgctgccaat
gtgtcagtcactcagccagaatctaccggggacccaaacaacatgactcttttggcagaa
gaggctcgaaagcttgctgaacgtcataaacaggaagctgatgacattgttcgagtggca
aagacagccaatgatacatcaactgaggcatacaacctgcttttgaggacactggcagga
gaaaatcaaacagcatttgagattgaagagcttaataggaagtatgaacaagtgaagaac
atctcacaggatctggaaaaacaagctgcccgagtacatgaggaggccaaaagggctggt
gacaaagctgtggagatctatgccagcgtggctcagctgagccctttggactctgagaca
ctggagaatgaagcaaataacataaagatggaagctgagaatctggaacatctgattgat
cagaaattaaaagattatgaggacctcaaagaagatatgagagggaaggaacttgaagtc
aagaaccttctggagaaaggcaagactgaacagcagaccgcagaccaactcctagcccga
gctgatgctgccaaggccctcgctgaagaagctgcaaagaagggacgggataccttacaa
gaagctaatgacattctcaacaacctgaaagattttgataggcgcgtgaacgataacaag
acggccgcagaggaggcgctaaggaagattcctgccatcaaccagaccatcattgaagct
aatgaaaagaccagggaagcccagcaggccctgggcaatgctgcagcggatgccacagag
gccaaaaacaaggcccatgaggcggagaggatcgcgagcgctgtccaaaagaatgccacc
agcaccaaggcagaagctgaaagaacttttgcagaagttacagatctggataatgaggtg
aacagtatgttgaagcaactacaggaagcagaaaaagagctaaagagaaaacaagatgac
gctgaccaggacatgatgatggcagggatggcttcacaggctgctcaagaagccgagatc
aatgccagaaaagccaaaaactctgttactagcctcctcagcattattaatgacctcttg
gagcagctggggcagctggatacagtggacctaaataagctaaacgagattgaaggcacc
ctaaacaaagccaaagatgaaatgaaggtcagcgatcttgataggaaagtgtctgacctg
gagaatgaagccaagaagcaggaggctgccatcatggactacaaccgagatatcgaggag
atcatgaaggacattcgcaatctggaggacatcaggaagaccttaccatctggctgcttc
aacaccccgtccattgaaaagccctag

DBGET integrated database retrieval system