KEGG   Pongo abelii (Sumatran orangutan): 100447118Help
Entry
100447118         CDS       T01416                                 

Gene name
USP12
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 12 isoform X1
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100447118 (USP12)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100447118 (USP12)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100447118 (USP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98 NapB CEBP_ZZ
Motif
Other DBs
NCBI-GeneID: 100447118
NCBI-ProteinID: XP_024086702
Position
13
AA seq 370 aa AA seqDB search
MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtctccaaattcgcctccatctgtaccatgggcgccaatgct
tcggcattagagaaagagattggtccagaacagtttccggtcaatgagcactattttgga
ttagtcaattttgggaatacctgctactgcaattcagttcttcaagcactttatttttgt
cgtccatttcgggaaaaagttcttgcgtataagagtcaacctaggaaaaaggagagcctt
cttacatgcttagcagatctcttccatagcatagccactcagaagaaaaaggttggagta
ataccccctaagaagttcatcacaagattacggaaagaaaatgagctttttgacaactac
atgcaacaagatgcccatgaattcttaaattacctactaaatacaattgctgatatttta
caagaagagagaaagcaggaaaaacaaaatggtcgcttacctaatggtaatattgataat
gaaaataataacagcacaccagacccaacgtgggttcatgagatttttcagggaacatta
actaatgaaaccagatgtcttacttgtgaaactataagcagcaaagatgaagatttttta
gacctttctgttgacgtggaacaaaatacatcaattactcactgcttaaggggtttcagc
aacacagaaactctgtgcagtgaatacaagtattactgtgaagagtgtcgcagcaaacag
gaagcacacaaacggatgaaagttaaaaaactgcccatgattctagctctacacctgaag
agatttaaatatatggatcaacttcatcgatatacaaaactctcttaccgggtagttttt
cctttagaacttcgtctatttaacacttcaggtgatgccaccaatccagacagaatgtac
gaccttgttgctgttgtggttcactgtggaagtggtcccaatcgaggccattatattgca
atagttaagagtcatgatttttggttgttgtttgatgacgacattgtagaaaaaatagat
gcacaagctattgaagaattctacgggttgacatcagatatctcaaagaactctgagtct
ggttacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system