KEGG   Pongo abelii (Sumatran orangutan): 100447159Help
Entry
100447159         CDS       T01416                                 

Gene name
COMP
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:pon04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:pon04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:pon04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:pon04510]
Human Diseases; Infectious diseases; Malaria [PATH:pon05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 754 aa AA seqDB search
MAPDTACVLLLTLAALGASGQGQSPLGSDVGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSARTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGLAFAKANKQVCTD
INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQESGCQRRAQRFCPDGSPSECHEH
ADCVLERDGXRSCLCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ
EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQK
DTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKNNPDQAD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDS
RDNCRLVPNPGQEDVDRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD
PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI
FGYQDSSSFYVVMWKQMEQLWWPARSLTTFPGYWQAVKSSTGPGEQLRNALWHTGDTESQ
VRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLG
VFCFSQENIIWANLRYRCNDTIPEDYETHQLRRA
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgacaccgcctgcgttcttctgctcaccctggctgccctcggcgcgtccgga
cagggccagagcccgttgggctcagacgtgggcccgcagatgcttcgggaactgcaggaa
accaacgcggcgctgcaggacgtgcgggagctgctgcggcagcaggtcagggagatcacg
ttcctgaaaaacacggtgatggagtgtgacgcgtgcgggatgcagcagtcagcacgcacc
ggcctacccagcgtgcggcccctgctccactgcgcgcccggcttctgcttccccggcgtg
gcctgcatccagacggagagcggcgcgcgctgcggcccctgccccgcgggcttcacgggc
aacggctcgcactgcaccgacgtcaacgagtgcaacgcccacccctgcttcccccgagtc
cgctgtatcaacaccagcccggggttccgctgcgaggcttgcccgccggggtacagcggc
cccacccacgagggcgtggggctggctttcgccaaggccaacaagcaggtttgcacggac
atcaacgagtgtgagaccgggcaacataactgcgtccccaactccgtgtgcatcaacacc
cggggctccttccagtgcggcccgtgccagcccggcttcgtgggcgaccaggagtccggc
tgccagcggcgcgcacagcgcttctgccccgacggctcgcccagcgagtgccacgagcat
gcagactgcgtcctggagcgcgatggctagcggtcatgcttgtgtgccgtcggctgggcc
ggcaacgggatcctctgtggtcgcgacactgacctggacggcttcccggacgagaagctg
cgctgcccggagcgccagtgccgtaaggacaactgcgtgacggtgcccaactcagggcag
gaggatgtggaccgcgatggcatcggagacgcctgcgatccggatgccgacggggacggg
gtccccaatgaaaaggacaactgcccgctggtgcggaacccagaccagcgcaacacggac
gaggacaagtggggcgatgcgtgcgacaactgccggtcccagaagaacgacgaccaaaag
gacacagaccaggacggccggggcgatgcgtgcgacgacgacatcgacggcgaccggatc
cgcaaccaggccgacaactgccctagggtacccaactcagaccagaaggacagtgatggc
gatggtataggggatgcctgtgacaactgtccccagaagaacaacccggatcaggcggat
gtggaccacgactttgtgggagatgcttgcgacagcgatcaagaccaggatggagacgga
catcaggactctcgggacaactgtcccacggtgcctaacagcgcccaggaggactcagac
cacgacggccagggtgatgcctgcgacgacgacgacgacaatgacggagtccctgacagt
cgggacaactgccgcctggtgcctaaccccggccaggaggacgtggacagggacggcgtg
ggcgacgtgtgccaggacgactttgatgcagacaaggtggtagacaagatcgacgtgtgt
ccggagaacgctgaagtcaccctcaccgacttccgggccttccagacagtcgtgctggac
ccggagggtgacgcgcagattgaccccaactgggtggtgctcaaccagggaagggagatc
gtgcagacaatgaacagcgacccaggcctggctgtgggttacactgccttcaatggcgtg
gacttcgagggcacgttccatgtgaacacggtcacggatgacgactatgcgggcttcatc
tttggctaccaggacagctccagcttctacgtggtcatgtggaagcagatggagcagctc
tggtggcccgcgaggtctctgactacctttcctgggtattggcaggctgtgaagtcttct
acaggccccggggaacagctgcggaacgctctgtggcatacaggagacacagagtcccag
gtgcggctgctgtggaaggacccgcgaaacgtgggttggaaggacaagaagtcctatcgt
tggttcctgcagcaccggccccaagtgggctacatcagggtgcgattctatgagggccct
gagctggtggccgacagcaacgtggtcttggacacaaccatgcgtggtggccgcctgggg
gtcttctgcttctcccaggagaacatcatctgggccaacctgcgttaccgctgcaatgac
accatcccagaggactatgagacccatcagctgcggcgagcctag

DBGET integrated database retrieval system