KEGG   Pongo abelii (Sumatran orangutan): 100447160Help
Entry
100447160         CDS       T01416                                 

Gene name
KAT2B
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100447160 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100447160 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100447160 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    100447160 (KAT2B)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100447160 (KAT2B)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100447160 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 520 aa AA seqDB search
MSEAGGAGPGGCGAGAGAGAGAGPGALPPQPTALPPAPPQGSPCAAAAGGSGACGPATAV
AAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSP
TPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKE
EDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPA
KERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSL
PRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKTTCCLPFILI
TIGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDE
AARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKH
KTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggctggcggggccgggccgggcggctgcggggcaggagccggggcaggggca
ggggccgggccgggggcgctgcccccgcagcctacggcgctgccgcccgcgcccccgcag
ggttccccctgcgccgctgccgccgggggctcgggcgcctgcggtccggcgacggcagtg
gctgcagcgggcacggccgaaggaccgggaggcggtggctcggcccgaatcgccgtgaag
aaagcgcaactacgctccgctccgcgggccaagaaactggagaaactcggagtgtactcc
gcctgcaaggccgaggagtcttgtaaatgtaatggctggaaaaaccctaacccttcaccc
actccccccagagccgatctgcagcaaataattgtcagtctaacagaatcctgtcggagt
tgtagccatgccctagctgctcatgtttcccacctggagaatgtgtcagaggaagaaatg
aacagactcctgggaatagtattggatgtggaatatctctttacctgtgtccacaaggaa
gaagatgcagataccaaacaagtttatttctacctatttaagctcttgagaaagtctatt
ttacaaagaggaaaacctgtggttgaaggctctttggaaaagaaacccccatttgaaaaa
cctagcattgaacagggtgtgaataactttgtacagtacaaatttagtcacctgccagcg
aaagaaaggcaaacaatagttgagttggcaaaaatgttcctaaaccgcatcaactattgg
catctggaggcaccatctcaacgaagactgcgatctcccaatgatgatatttctggatac
aaagagaactacacaaggtggctgtgttactgcaacgtgccacagttctgcgacagtcta
cctcggtatgaaaccacacaggtgtttgggagaacattgcttcgctcggtcttcactgtt
atgaggcgacaactcctggaacaagcaagacaggaaaaagataaactgcctcttgaaaaa
cgaactctaatcctcactcatttcccaaaaaccacctgttgtttgccttttattttgatc
accataggagaaaagaggaaaatgactgattctcatgttctggaggaggccaagaaaccc
cgagttatgggggatattccgatggaattaatcaacgaggttatgtctaccatcacggac
cctgcagcaatgcttggaccagagaccaattttctgtcagcacactcagccagggatgag
gcggcaaggttggaagagcgcagaggtgtaattgaatttcacgtggttggcaattccctc
aaccagaaaccaaacaagaaaatcttgatgtggctggttggcctacagaacgttttctcc
caccagctgccccgaatgccaaaagaatacatcacacggctcgtctttgacccgaaacac
aaaacccttgctttaattaaagatggccgtgttattggtggtatctgtttccgtatgttc
ccatctcaaggattcacagagattgtcttctgtgctgtaacctcaaacgagcaagtcaag

DBGET integrated database retrieval system