KEGG   Pongo abelii (Sumatran orangutan): 100447210Help
Entry
100447210         CDS       T01416                                 

Gene name
FLNC
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100447210 (FLNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100447210 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100447210 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    100447210 (FLNC)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100447210 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 2754 aa AA seqDB search
MRPNGLPVRGVEGAYFIPDSLVCWVWMENCRPSPPPSSAAAPGAQGTNEMPSAEKDLAED
APWKKIQQNTFTRWCNEHLKCVGKRLTDLQRDLSDGLRLIALLEVLSQKRMYRKFHPRPN
FRQMKLENVSVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDE
DDEDARKQTPKQRLLGWIQNKVPQLPITNFNRDWQDGKALGALVDNCAPGLCPDWEAWDP
NQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSK
QLNPKKAIAYGPGIEPQGNTVLQPAHFTVQTVDAGVGEVLVYIEDPEGHTEEAKVVPNND
KDRTYAVSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNV
ANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTFRCTYRPVMEGPHTVH
VAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELRV
TVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPEAGV
QKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYW
PTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFT
IDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPK
SPFRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVG
PAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSHDASRVK
AEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVQFAGTAKGEVVRDFEIIDNHDYSYTVK
YTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKIKVQGLNSKVAVGQEQAFSVNTR
GAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSP
FAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQD
NGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSKVRASGPGLERGKVG
EAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYG
GHPVPKFPTRVHVQPAVDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTAR
VLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPT
RVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIP
FTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQ
AGRAPLQVAVLGPTGVPEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKI
KVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR
DNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLG
ACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEP
GKYVITIRFGGEHIPNSPFHVLACDPLPHEEEPSEVPQLRQPYAPPRPGARPTHWATEEP
VVPVEPMESMLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEK
GLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGG
LSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDS
MRTSQLNVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVG
EHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGY
GGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGE
GRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERT
EISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMT
AQVTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGE
GGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGV
SYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAV
QLNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSP
FKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLD
CRECPEGHVVTYTPMAPGNYLIAIKYWWPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLV
ETVTKSSSSRGSGYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVG
VHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP
NT seq 8265 nt NT seq  +upstreamnt  +downstreamnt
atgaggccaaacgggctgcccgtgcggggtgtggagggagcatatttcattcctgacagt
ttggtgtgttgggtgtggatggagaactgtcggccctccccgccaccttccagcgcggcg
gcaccgggggcccaggggacaaacgagatgccgtccgcggagaaggacctggcggaggac
gcgccgtggaagaagatccagcagaacacattcacgcgctggtgcaatgagcacctcaag
tgcgtgggcaagcgcctgaccgatctgcagcgcgacctcagcgatgggctccggctcatc
gcgctgctcgaggtgctcagccagaagcgcatgtaccgcaagttccatccgcgccccaac
ttccgccaaatgaagctggagaacgtgtccgtggccctcgagttcctcgagcgcgagcac
atcaagctcgtgtccatagacagcaaggccatcgtggatgggaacctgaagctgatcctg
ggcctgatctggacgctgatcctgcactactccatctccatgcccatgtgggaggatgaa
gatgatgaggacgcccgcaaacagacgcccaagcagcggctgcttggctggatccagaac
aaggtgccccagctgcccatcaccaacttcaaccgtgactggcaggatggcaaagctctg
ggcgccctggtggacaactgcgcccccggtctctgccccgactgggaggcctgggacccc
aaccagcccgtggagaacgcccgggaggccatgcagcaggccgacgactggcttggggtg
ccccaggtcattgcccctgaggagatcgtggaccccaacgtggatgagcattctgttatg
acctacctgtcccagttccccaaggccaagctcaaacctggcgcccctgttcgatccaag
cagctgaaccccaagaaagccatcgcctatgggcctggcatcgagccacagggcaacacc
gtgctgcagcctgcccacttcaccgtgcagacggtggacgcaggtgtgggcgaggtgctg
gtctacatcgaggaccctgaaggccacaccgaggaggccaaggtggttcccaacaatgac
aaggatcgcacctatgccgtgtcctatgtgcccaaggtcgctgggttacacaaggtgacc
gtgctctttgctggccagaacattgaacgcagtccctttgaggtgaacgtgggcatggcc
ctgggagatgccaacaaggtgtcagcccgtggccctggcctggaacctgtgggcaacgtg
gccaacaaacccacctactttgacatctacactgcgggggccggcactggcgatgttgct
gtagtgatcgtggacccacagggccggcgggacacagtggaggtggccctggaggacaag
ggtgacagcacgttccgctgcacatacagacctgtcatggaggggccacataccgtgcat
gtggcgtttgcgggtgcccccatcacccgcagtcccttccctgtccacgtgtcggaagcc
tgtaaccccaatgcctgccgcgcctctgggcgaggcctgcagcccaagggtgttcgtgtg
aaagaggtggctgacttcaaggtgtttaccaagggtgccggcagcggggagctcagggtc
acggtcaaggggccaaagggcacagaggagccggtgaaggtgcgggaggctggggacggt
gtgttcgagtgcgagtactacccggtggtgcctgggaagtatgtggtgaccatcacgtgg
ggcggctacgccatccctcgcagcccctttgaggtacaggtgagcccagaggcaggagtg
caaaaggtccgggcctggggtcctggtttggagactggccaggtgggcaagtcagctgat
tttgtggtggaagccattggcaccgaggtggggacactgggcttctccatcgaggggccc
tcacaagccaagatcgaatgtgacgacaaaggggatggctcctgtgatgtgcggtactgg
cccacggagcctggggagtacgctgtgcacgtcatctgtgatgatgaggacatccgagac
tcacccttcattgcccacatcttgcccgccccacctgactgcttcccagataaggtgaag
gcctttgggcctggcctggagcctaccggctgcatcgtggacaagcccgctgagttcact
attgatgcccgtgcagctggcaagggagacctgaagctctatgcccaggacgcggacggc
tgtcccatcgacatcaaggtgatccccaacggcgacggcaccttccgctgctcctacgtg
cccaccaagcccattaagcacaccatcatcatctcctggggaggcgtaaatgtgcccaag
agccccttccgggtgaacgtgggcgagggcagccaccccgagcgggtaaaggtgtacggc
cccggcgtggagaagacgggcctcaaggccaatgagcccacctacttcaccgtggactgc
agcgaggcggggcaaggcgacgtgagcatcggcatcaagtgcgccccaggcgtggtgggc
cctgcagaggctgacatcgacttcgacatcatcaagaatgacaacgacaccttcaccgtc
aagtacacgccaccgggggcgggccgctacaccatcatggtgctgtttgccaaccaggag
atccccgccagccccttccacatcaaggtggacccatcccacgatgccagcagagtcaag
gcggagggccctgggctgaatcgcacaggtgtggaagtcgggaagcccacccacttcacg
gtgctgaccaagggagctggcaaggccaagctggatgtgcagtttgcagggacagccaag
ggcgaggttgtgcgggactttgagatcatagacaaccatgactactcctacactgtcaag
tacaccgctgtccagcagggcaacatggcggtgacagtaacctatggcggggaccctgtc
cccaagagcccctttgtggtgaatgtggcacccccgctggaccttagcaaaatcaaagtt
cagggcctcaatagcaaggtggctgtgggacaggaacaagcattctctgtgaacacacga
ggggctggcggtcagggccaactggatgtgcggatgacttcgccctctcgccggcccatc
ccctgcaagctggagccaggcggtggagcggaagcccaggctgtgcgctacatgcccccg
gaggaggggccctacaaggtggacatcacctacgatggccacccggtgcctggcagcccc
tttgctgtggagggtgtcctgccccctgatccctccaaggtctgtgcttatggccccggt
ctcaagggtggactggtaggcacccccgcaccattctccatcgacaccaagggggctggc
acaggtggcctggggctgactgtggagggcccctgcgaggccaagatcgagtgccaggac
aatggtgatggctcatgtgctgtcagctacctgcccacggagcctggcgagtacaccatc
aacatcctgtttgccgaagcccacatccctggctcgcccttcaaagccaccattcggcct
gtgtttgacccaagcaaggtgcgggccagtggaccaggcctggagcgcggcaaggtcggt
gaggcagccaccttcactgtggactgctcagaggctggcgaggcagagctgaccattgag
atcctgtcggatgccggggtcaaggccgaggtgctgatccacaacaacgcggacggcacc
taccacatcacctacagccccgccttccctggcacctacaccattaccatcaagtatggc
gggcatcccgtgcccaaattccccacccgagtccatgtgcagcctgcggtcgataccagt
ggcgtcaaggtctcagggcctggtgttgagccacacggtgttctgcgggaggtgaccact
gagttcactgtggatgcaagatccctaacagccacaggcggcaaccacgtgacggctcgc
gtgctcaacccctcaggggccaagacagacacctatgtgacagacaatggggacggcacc
taccgagtgcagtacaccgcctacgaggagggcgtgcatttggtggaggtcctgtatgat
gaggtcgctgtgcccaagagccccttccgagtgggagtgaccgagggctgtgatcccacc
cgagtccgggccttcgggccaggcctggagggtggcttggtcaacaaggccaaccgcttc
actgtggagaccaggggagcgggcactgggggccttggcctagccatcgagggtccctcg
gaagccaagatgtcctgcaaggacaacaaggatggtagctgcaccgtggagtacatcccc
ttcactcctggagactatgacgtcaacatcaccttcggggggcggcccatcccagggagc
ccgttccgggtgccagtgaaggatgtggtggaccctgggaaggtgaagtgctcggggcca
gggctgggggccggtgtcagggcccgggttccccagaccttcacagtggactgcagtcaa
gctggccgggcgcccctgcaggtggctgtgctgggccccacaggtgtgcccgagcctgtg
gaggtacgggacaatggagatggcacccacactgtccactacaccccagccactgacggg
ccctacacggtagctgtcaagtatgccgaccaggaggtgccacgcagccccttcaagatc
aaggttctcccagctcatgatgccagcaaggtgcgggccagcggcccaggcctcaatgcc
tctggcatccctgccagcctgcctgtggagttcaccatcgacgcacgggacgcgggcgag
gggttgctcacagtccagatcttggaccccgagggtaagcccaagaaggccaacatccgg
gacaatggggatggcacgtacaccgtgtcctacctgccggacatgagcggccggtacacc
atcaccatcaagtatggcggtgacgagatcccctactcacccttccgcatccatgctctg
cccaccggggacgccagcaagtgcctcgtcacagtgtccattggaggccatggcctgggc
gcctgcctgggcccccgaatccagattgggcaggagacggtaatcacagtggatgccaag
gcagctggcgaggggaaggtgacatgcacggtgtccacgccggatggggcagagctcgat
gtggatgtggttgagaaccacgatggtacctttgacatctactacacagcgcccgagccg
ggcaagtacgtcatcaccatccgcttcgggggcgagcacatccccaacagccccttccac
gtgctggcgtgtgaccccctgccgcacgaggaggagccctctgaagtgccacagctgcgc
cagccctacgctcctccccggcctggcgcccgccccacacactgggccacagaggagcca
gtggtgcctgtggagccaatggagtccatgctgaggcccttcaacctggtcatccccttc
gcggtacagaaaggggagctcacaggagaggtgcggatgccctcggggaagacggcgcgg
cccaacatcaccgacaacaaggacggcaccatcacggtgaggtacgcacccaccgagaaa
ggcctgcaccagatggggatcaagtatgacggcaaccacatccctgggagccccttgcag
ttctatgtggatgccatcaacagccgccatgtcagtgcctatgggccaggcctgagccat
ggcatggtcaacaagccagccaccttcactattgtcaccaaagatgctggagaagggggt
ctgtcactggccgtggagggcccatccaaggcagagatcacctgtaaggacaacaaggat
ggcacctgcaccgtgtcctacctgccaaccgcccctggagactacagcatcatcgtgcgc
ttcgatgacaagcacatcccagggagccccttcacagccaagatcacaggcgatgactcc
atgaggacctcacagctgaatgtgggcacctccacggacgtgtcactgaagatcaccgag
agtgatctgagccagctgaccgccagcatccgtgccccctcgggcaacgaggagccctgc
ctgctgaagcgcctgcccaaccggcacattgggatctccttcacccccaaggaggtcggg
gagcacgtggtgagtgtgcgcaaaagtggcaagcacgtcaccaacagccccttcaagatc
ctggtggggccatctgagatcggggacgccagcaaggtgcgggtctggggcaagggcctt
tccgagggacacacgttccaggtggcagagttcatcgtggacactcgcaatgcaggttat
gggggcttggggctgagtattgaaggcccaagcaaagtggacatcaactgtgaggacatg
gaggacgggacatgcaaagtcacctactgccccaccgagcctggcacctacatcatcaac
atcaagtttgctgacaagcacgtgcctggaagccccttcactgtgaaggtgaccggcgag
ggccgcatgaaggagagcatcacccggcggagacaggcgccttccatcgccaccatcggc
agcacctgtgacctcaacctcaagatcccaggaaactggttccagatggtgtctgcccag
gagcgcctgacgcgcaccttcacgcgcagtagccacacctacacccgcacagagcgcacg
gagatcagcaagacgaggggcggggagacaaagcgcgaggtgcgggtggaggagtccacc
caggtcggcggggaccccttccctgctgtgtttggggacttcctgggccgggagcgcctg
ggctccttcggcagcatcacccggcagcaggagggtgaggccagctctcaggacatgact
gcacaggtgaccagcccatcgggcaagatggaagctgcagagatcgtcgagggcgaggac
agcgcctacagcgtgcgctttgtgccccaggagatggggccccatacagtcgctgtcaag
taccgcggccagcatgtgcccggcagcccctttcagttcactgtggggccgctgggtgaa
ggcggtgcccacaaggtgcgggccggaggcacagggctggagcgaggtgtggccggcgtg
ccagctgagttcagcatctggacccgggaggccggcgctgggggcctgtccattgctgtg
gagggtcctagcaaagcggagattgcatttgaggatcgcaaagatggctcctgcggcgtc
tcctatgtcgtccaggaaccaggtgactatgaggtctccatcaagttcaatgatgagcac
atcccagacagcccctttgtggtgcccgtggcctccctctcggatgatgctcgccgtctc
actgtcaccagcctccaggagacggggctcaaggtgaaccagccggcgtcctttgcggta
cagctgaacggcgcccggggcgtgattgatgcccgggtgcacacaccctcgggggctgtg
gaggagtgctacgtctctgagctggacagtgacaagcacaccatccgcttcatcccccac
gagaatggcgtccactccatcgatgtcaagttcaacggtgcccacatccctggaagtccc
ttcaagatccgcgttggggagcagagccaggctggggacccaggcttggtgtcagcctac
ggtcctgggctcgagggaggcactactggtgtgtcatcagagttcatcgtgaacaccctg
aatgccggctcaggggccttgtctgtcaccattgatggcccctccaaggtgcagctggac
tgtcgggagtgtcctgagggccacgtggtcacttacactcccatggcccctggcaactac
ctcattgccatcaagtactggtggccccagcacatcgtgggcagccccttcaaggccaag
gtcactggtccgaggctgtccggaggccacagccttcacgaaacatccacggttctggtg
gagactgtgaccaagtcctcctcaagccggggctccggctacagctccatccccaagttc
tcctcggatgccagcaaggtggtgactcggggccctgggctgtcccaggccttcgtgggc
cagaagaactccttcaccgtggactgcagcaaagcaggcaccaacatgatgatggtgggc
gtgcacggccccaagaccccctgtgaggaggtgtacgtgaagcacatggggaaccgggtg
tacaatgtcacctacactgtcaaggagaaaggggactacatcctcatcgtcaagtggggt
gacgaaagtgtccctggaagccccttcaaagtcaaggtcccttga

DBGET integrated database retrieval system