KEGG   Pongo abelii (Sumatran orangutan): 100447221Help
Entry
100447221         CDS       T01416                                 

Definition
chymotrypsinogen B2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 241 aa AA seqDB search
MCQGGPELASVDWGRTGRPACRQVRPRWGLGPRPFFTPLPPPGCGVPAIHPVLSGLSRIV
NGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVVGEFDQGSDE
ENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCA
TTGWGKTKYNANKTPDKLQQATLPLLSNAECKKSWGRRITDVMICAGASGISSCKVRLAL
A
NT seq 725 nt NT seq  +upstreamnt  +downstreamnt
atgtgccagggaggtcctgagctggcctcagtggactggggtagaaccgggagacctgca
tgcaggcaggtgaggcccaggtggggtttggggcctcggcccttcttcaccccactcccg
cccccaggctgcggggtccccgccatccaccccgtgctcagcggcctgtccaggatcgtg
aatggggaggacgccatccccggctcctggccctggcaggtgtccctgcaggacaaaacc
ggcttccacttctgcggaggctccctcatcagcgaggactgggtggtcaccgccgcccac
tgcggggtcaggacctccgacgttgtcgtggttggggagtttgaccagggctctgacgag
gagaacatccaggtcctgaagatcgccaaggtcttcaagaaccccaagttcagcattctg
accgtgaacaatgacatcaccctgctgaagctggccacacctgcccgcttctcccagacg
gtgtccgctgtgtgcctgcccagtgccgacgacgacttccccgcggggacactgtgtgcc
accacaggctggggcaagaccaagtacaacgccaacaagacccccgataagctgcagcag
gcgaccctgcccctcctgtccaatgccgaatgcaagaagtcctggggcagaaggatcaca
gacgtgatgatctgtgccggggccagtggcatctcctcctgcaaggtgagactggccctg
gccag

DBGET integrated database retrieval system