KEGG   Pongo abelii (Sumatran orangutan): 100447313Help
Entry
100447313         CDS       T01416                                 

Definition
inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 7-like
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 236 aa AA seqDB search
SVPYPECLDMQPYMSQQNAGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAE
VTASGITSVLSQQAYVLFYIQKSEWERHSESVSRGREARALGAEDTDRRATQGELKRDPC
LQVPELDEHLVETATQESTLDHWKFLQEQNKTKPDFNVRKVEGTLPPNVHVIHQSKYKCR
MKNHHPEQQSSLLNVSSTNPTDHESMNTGTLSSLQGRTRRSKGKNKHSKRALLLCQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
agtgtgccatatcctgagtgccttgacatgcagccatacatgtctcagcagaacgcagga
cctcttgtctatgtcctctatgctgtgctggtccacgccgggtggagctgtcacaacgga
cattacttctcttatgtcaaagctcaagaaggccagtggtataaaatggatgatgccgag
gtcactgcctctggcatcacttctgtcctgagtcaacaggcctatgtcctcttttacatc
cagaagagtgaatgggaaagacacagtgagagtgtgtcaagaggcagggaagcaagagcc
cttggcgctgaagacacagacaggcgagcaacgcaaggagagctcaagagagacccctgc
ctccaggtacccgagttggacgagcacttggtggaaacggccactcaggaaagcacctta
gaccactggaaattcctccaagagcaaaacaaaaccaagcctgacttcaacgtcagaaaa
gtcgaaggtaccctgcctcccaacgtacatgtgattcatcaatcgaaatacaagtgtcgg
atgaaaaaccaccatcctgaacagcaaagctctctgctaaacgtctcttcaacgaacccg
acagatcacgagtccatgaacactggcacactctcttctctgcaagggaggaccaggaga
tccaaagggaagaacaaacacagcaagagggctctgcttctgtgccagtga

DBGET integrated database retrieval system