KEGG   Pongo abelii (Sumatran orangutan): 100447313Help
Entry
100447313         CDS       T01416                                 

Definition
inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 7-like
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100447313
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100447313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 236 aa AA seqDB search
SVPYPECLDMQPYMSQQNAGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAE
VTASGITSVLSQQAYVLFYIQKSEWERHSESVSRGREARALGAEDTDRRATQGELKRDPC
LQVPELDEHLVETATQESTLDHWKFLQEQNKTKPDFNVRKVEGTLPPNVHVIHQSKYKCR
MKNHHPEQQSSLLNVSSTNPTDHESMNTGTLSSLQGRTRRSKGKNKHSKRALLLCQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
agtgtgccatatcctgagtgccttgacatgcagccatacatgtctcagcagaacgcagga
cctcttgtctatgtcctctatgctgtgctggtccacgccgggtggagctgtcacaacgga
cattacttctcttatgtcaaagctcaagaaggccagtggtataaaatggatgatgccgag
gtcactgcctctggcatcacttctgtcctgagtcaacaggcctatgtcctcttttacatc
cagaagagtgaatgggaaagacacagtgagagtgtgtcaagaggcagggaagcaagagcc
cttggcgctgaagacacagacaggcgagcaacgcaaggagagctcaagagagacccctgc
ctccaggtacccgagttggacgagcacttggtggaaacggccactcaggaaagcacctta
gaccactggaaattcctccaagagcaaaacaaaaccaagcctgacttcaacgtcagaaaa
gtcgaaggtaccctgcctcccaacgtacatgtgattcatcaatcgaaatacaagtgtcgg
atgaaaaaccaccatcctgaacagcaaagctctctgctaaacgtctcttcaacgaacccg
acagatcacgagtccatgaacactggcacactctcttctctgcaagggaggaccaggaga
tccaaagggaagaacaaacacagcaagagggctctgcttctgtgccagtga

DBGET integrated database retrieval system