KEGG   Pongo abelii (Sumatran orangutan): 100447321Help
Entry
100447321         CDS       T01416                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100447321 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 2010 aa AA seqDB search
ASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKNVQQHEKVQKA
STEGVAIQGQQGTRLLPEQLVKEAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRGLV
AVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELASMTTRFTDELMEQGLTYKVLTLV
SQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSPLGKEDTLLLI
GHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPLLTEKQYIATI
HSRLQDSQLWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMAELAIADNVFL
FLTESVVVSEYFYQEEFYIRRVHNLITDFLALMPMKVKQLRNRADEDARMIHMSMQMGNE
PPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTIMGSYLGVAHQRPPQR
QVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSSHVENIQGAGG
SPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAFLQLTSTIVTW
SENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAAFGKSPEIAASLWQSLEYT
QILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFPSNLGAGLRPP
GFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQFVEL
QGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKKHLEKAVQHCL
ALLNLTLQKENLFMDLLRESQLALIVCPLEQLLQGINPRTKKADNVVNIARYLYHGNTNP
ELAFESAKILCCISCNSNIQIKLVGDFTHDQSVSQKLMAGFVECLDCEDAEEFVRLEEGS
ELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLGFELKKPVSTTNLQDPGVLGCPR
TCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQDF
LFSQLQYLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLLHLLLDDMPVK
PYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDSIDFSQEIPEPLQLDFFDRAQIE
QVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTVLQYVVGRN
KLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHDKILDDEAAQE
LMPVVAGAVFTLTAHLSQAVLTEQKQTSVLGPAEAHYAFMLDSCFTSPPPEENPLVGFAS
IGDSSLYIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWE
RLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRVKACWPVALLDRIVSVD
KQQQWLLYLSNQWLLKVLVDSLVERTVLLQSLLTPQPPPFKSTLYLLNLKMAFLTRVAKI
QQGCIRLLRSGVIVRLAQCQVYDMRPETDPQSMFGMRDPPMFIPTPVDRYRQILLPALQL
CQVILTSSMAQHLQAAGITGKVLQFLISHSDTIQAILRCQDVSLLGSLQELALLTGIISK
AALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEGDK
VSKKDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETVNRDGPRQDTQAP
VVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELCQSVMPAG
VDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCMPTDSQD
SLFASRTLFKSRRLQDSFASDTHLDFRSALAIVSQHDLDQLQADAINAFGESLQKKLLDI
EGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6035 nt NT seq  +upstreamnt  +downstreamnt
ctgctagtctatggggtccttacaaagacatttggcataaagtgggaaatgctctttgga
gaagacaacctgaagctgttcaccttcttgataagattttgaagaaacacaaacctgact
tcatctcattgttcaaaaatccgccaaaaaatgttcaacagcatgagaaggttcagaaag
ccagtacagagggagttgccattcagggtcaacagggaactcgacttcttcctgaacagc
tcgttaaagaagcctttattctcagtgacctttttgatattggagaattggcagctgttg
agcttcttcttgctggagagcatcaacagccacattttcctggccttaccagaggattag
tagctgttcttttgtactgggatggaaagcgatgcattgcaaattccttgaaagccttga
tacagtctagacggggaaagacatggaccctagaactcagtccagagctggcatccatga
caacacgctttacagatgagctgatggagcaaggattgacttataaagttcttaccctgg
tgtcacaaattgatgtgaataatgagtttgagaaactacagcgagagagaggtttgggca
gtgaaaaacatcgcaaagaggtttctgatctcattaaggagtgcaggcagtctcttgcag
aaagcctttttgcctgggcttgccagtcacctttaggcaaagaagacactctcctcctca
ttggacatttggaaagagtgacagttgaggctaatggctcactggatgcagtgaatttgg
ctcttcttatggcgcttctatactgttttgatatcagttttatagagcaaagcacagagg
aacgagatgatatgattcatcaacttccactgttgacagaaaaacagtacattgcaacaa
ttcactctcgtcttcaggactcacagctttggaaactgcctgggctccaagccactgtta
gacttgcctgggcgctggcattgaggggaatatcccagctacctgatgtgacagctctgg
cagaattcacagaggcagatgaagcaatggcagagctcgcaattgctgacaacgttttcc
tgttcctcacggaatctgtagtggtatcagaatacttttatcaggaagaattttatattc
gcagagtccataatctcatcacagatttccttgcacttatgccaatgaaggtgaaacagc
tgaggaatcgggcagatgaagatgctcgaatgattcacatgagtatgcagatgggtaatg
aaccccccatttcacttagaagggacctggaacacttaatgcttttgattggcgagctat
ataaaaagaacccttttcatctggagcttgctctagaatattggtgtcccacagagcctc
ttcagactccgactatcatgggttcttatctaggggtggctcatcagcggccccctcaac
gccaggttgtcttgtcaaagtttgttaggcaaatgggtgacctgttgcctccaactattt
atattccttatttgaagatgctccagggattggccaatgggcctcagtgtgcccactact
gtttcagcctgctcaaagtcaatggtagtagtcatgttgaaaatattcagggcgcaggtg
gcagtcctgtttcctgggaacatttctttcactctttgatgctttaccatgaacaccttc
ggaaggatcttccaagtgcagatagcgtccagtaccggcaccttccttcccgtggcatca
cccagaaggagcaagatggattgattgcttttttgcagctcacgtctaccatcgttactt
ggagtgaaaatgctcgcttggcactctgtgaacaccctcagtggacccctgttgtagtga
ttctgggactcctccaatgtagtattccccctgtcctaaaagctgagctactgaagacac
ttgcagcttttggaaaatctcctgaaattgctgcttccctctggcagtcattggaataca
ctcagatactgcagactgtgaggattccaagccaaaggcaagctattggtatcgaggttg
aactaaatgaaatagaatcccggtgtgaagaatacccattgactcgggccttttgccagc
ttattagtaccctggtggagagctcatttccttctaatttgggtgctggactgcggcccc
ctggctttgacccttatttgcagttccttagagactctgtgtttctacgattccgtacga
gagcttaccggagagcagctgaaaagtgggaagttgctgaggtggttttggaggtgtttt
ataaattgctcagagattatgagcctcagcttgaagattttgtagaccagtttgtggaac
tacaaggagaagaaatcatagcctataagccacctggatttagtctgatgtatcatctgc
tgaatgagtcaccaatgttggagcttgctctcagtttactggaagaaggagttaagcagc
ttgacacctatgccccctttcctgggaaaaaacacctggagaaagcagtacagcattgcc
ttgcacttctcaatcttactctgcaaaaggaaaatctttttatggaccttctaagagaga
gtcaactggctctaatagtctgtcctttagaacagcttttgcagggaattaatcccagaa
ctaagaaggcagataatgtggtaaacattgccagatacctatatcatggcaatactaatc
cagaattggcttttgaaagtgccaagatcctctgttgtatctcttgcaactctaatattc
agataaagttggttggagatttcacacatgaccagagtgtaagtcagaaactaatggctg
gatttgtggagtgtttggattgtgaagatgcagaagaatttgtacgtctggaagagggat
cagaacttgaaaagaaattagttgcaattcgtcatgaaacaagaatccacatcttgaatc
ttctcattacctctctggaatgcaatccacccaaccttgctctctacttgttgggctttg
aattgaagaaacctgtcagtactacaaacctacaagatccaggagtgttaggttgccctc
ggacatgccttcacgccattctaaacatcttggagaaaggaacggaagggagaacaggcc
cagtggcagtgcgagaatctcctcaactggctgagctatgttaccaggtcatatatcagt
tatgtgcatgctctgatacatctggtcctactatgaggtacttgagaaccagccaggatt
tcttattttcccagttgcagtatctaccattttctaacaaagaatatgaaatatctatgc
tgaaccagatgtcatggcttatgaaaactgcctcaatagagctaagggtaacctctctga
atcgtcagcggtcgcatacccagaggctcctacacctcttattggatgacatgccagtga
aaccatactcagatggtgaaggaggaatagaagatgaaaacaggtctgtttctgggttcc
ttcactttgacactgctacaaaagtacgtcgaaaaattctaaatattcttgactcgattg
acttcagtcaggagatccctgagcctttgcagttggatttttttgatcgggcccagattg
aacaagttattgctaactgtgaacacaagaatttacggggacagacagtctgcaatgtca
agcttcttcatagggttcttgtagctgaagtaaatgcccttcagggtatggcagccatag
gacagagacctctactcatggaggaaataagcactgtacttcagtatgtggtaggaagaa
ataaattgctgcagtgtcttcatgcaaaacgtcatgctctggaatcgtggaggcaactgg
tagaaattatactgacagcttgtccccaggacctcattcaggcagaggatcgacaactga
ttattcgtgatattttacaagatgtgcatgataagatactggatgatgaagcagcgcaag
agttaatgcctgtggtcgccggggcagtgttcacactaactgctcacctaagccaggccg
tcctcaccgaacagaagcaaacatcagtcttgggaccagcagaggcccattacgctttta
tgcttgatagttgcttcacctcacctcctccagaagagaacccattagtgggttttgctt
ctattggagattcttcactttacatcatattgaagaaactgttagacttcattttgaaga
caggtggtggattccaacgagtgaggactcacttgtatggctctctgctttattacttac
agattgcccagagacctgatgaaccagataccttagaagcagccaagaaaaccatgtggg
aaaggctgacagcccctgaagatgtatttagcaaattacagcgagaaaacatagccatta
ttgaaagttatggcgccgccctcatggaagtggtctgtcgagatgcttgtgatggtcatg
agattggaagggtaaaagcntgctggcccgtggctctacttgatagaattgtctctgtgg
ataaacagcagcagtggcttttgtatctttctaatcagtggctacttaaggtcctcgtag
acagcttggtagaaagaaccgtacttttgcagagcttactcacaccacagcctccccctt
ttaaaagcactttatacttattgaatctaaaaatggcatttctaacaagagtggcaaaga
tacagcagggttgcattaggctgctaagatcaggggtgattgtgagactagctcaatgcc
aagtctatgacatgcgcccagaaacggacccacagagcatgtttggcatgagagaccctc
caatgttcatccctaccccagtggatcgctaccgccagattctcctcccagctctccagc
tgtgccaggtcatcctcacatctagtatggcccagcacttgcaggcagcagggataacag
gtaaggtattgcagtttcttatttcacattctgataccatacaagcaattctgcgctgtc
aggatgttagtttgctagggtctttgcaggaattggctctgctgacaggaattataagta
aagcagcacttcctgggatattaagtgaacttgacgttgatgtaaatgaagggtctctaa
tggagctacagggacatattggaagattccagcgccagtgcttaggactactaagtcgct
ttggtggctctgacagactgcgtcagtttaaatttcaagacgataatgtggagggagata
aagtaagcaagaaagatgagattgaactggctatgcagcagatttgtgccaatgtaatgg
aatattgccaatcgctcatgttacagagttcccctaccttccagcatgctgtgtgtctct
tcactcctagcctttcagaaacagttaatagagatggaccgcggcaagatacccaagctc
cagtggttccatactggcgcctgcctggtttaggcattatcatctacctgctgaaacaga
gtgctaatgatttcttcagctattatgacagtcatcgacagagtgtcagcaagctacaaa
atgtagagcagcttcccccagatgagataaaagagttgtgtcagtctgtgatgcctgctg
gtgttgataaaatctccactgcccagaaatatgttctagcaagacggcgcttggtgaagg
tgatcaacaatcgagctaaactgctttccctttgttcttttatcatagagacctgcctat
ttattctttggcgccatctggagtactacttgttacattgcatgcccacggattctcaag
attccttatttgcttcgagaaccttgtttaaaagcagaagactgcaagattccttcgcct
cagacacccatctagattttagaagtgcgctggctatagtgagccaacatgatttagacc
agcttcaggctgatgcaatcaacgcttttggagaatcactacaaaagaaacttctggaca
ttgaaggattatattcaaaagttcgatctcgatatagtttcatacaggctcttgtcagac
gtatccgtggcctcttgaggatatcaaggaactga

DBGET integrated database retrieval system