KEGG   Pongo abelii (Sumatran orangutan): 100447350Help
Entry
100447350         CDS       T01416                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:pon04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:pon04722]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:pon05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:pon05030]
Human Diseases; Substance dependence; Alcoholism [PATH:pon05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 304 aa AA seqDB search
MRHLNAAATTAVGPAGSSTATATGAGRWSQNRNHDVTPPPGTRELCVDPEFHQVRRVMTI
LFLTMVISYFGCMKAAPMKEANVRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTF
EHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMS
MRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYE
TKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTI
KRGR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagacacttgaatgcagctgccaccactgccgtggggccggcgggaagcagcaccgcg
acggcgaccggggctgggcgctggagccagaatcggaaccacgatgtgactccgccgccg
gggacccgtgagctttgtgtggaccccgagttccaccaggtgagaagagtgatgaccatc
cttttccttactatggttatttcatactttggttgcatgaaggctgcccccatgaaagaa
gcaaacgtccgaggacaaggtggcttagcctacccaggtgtgcggacccatgggactctg
gagagcgtgaatgggcccaaggcgggttcaagaggcctgacatcgttggctgacactttc
gaacatgtgatagaagagctgttggatgaggaccagaaagttcggcccaatgaagaaaac
aataaggacgcagacttgtacacgtccagggtgatgctcagtagtcaagtgcctttggag
cctcctcttctctttctgctggaggaatacaaaaattacctagatgctgcaaacatgtcc
atgagggtccggcgccactctgaccctgcccgccgaggggagctgagcgtgtgtgacagt
attagcgagtgggtaacagcggcagacaaaaagactgcagtggacatgtcgggcgggacg
gtcacagtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatacttctacgag
accaagtgcaatcccatgggttacacaaaagaaggctgcaggggcatagacaaaaggcat
tggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatggatagcaaa
aagagaattggctggcgattcataaggatagacacttcttgtgtatgtacattgaccatt
aaaagaggaagatag

DBGET integrated database retrieval system