KEGG   Pongo abelii (Sumatran orangutan): 100447350Help
Entry
100447350         CDS       T01416                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100447350 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    100447350 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100447350 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    100447350 (BDNF)
   05034 Alcoholism
    100447350 (BDNF)
Cytokines [BR:pon04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    100447350 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 304 aa AA seqDB search
MRHLNAAATTAVGPAGSSTATATGAGRWSQNRNHDVTPPPGTRELCVDPEFHQVRRVMTI
LFLTMVISYFGCMKAAPMKEANVRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTF
EHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMS
MRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYE
TKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTI
KRGR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagacacttgaatgcagctgccaccactgccgtggggccggcgggaagcagcaccgcg
acggcgaccggggctgggcgctggagccagaatcggaaccacgatgtgactccgccgccg
gggacccgtgagctttgtgtggaccccgagttccaccaggtgagaagagtgatgaccatc
cttttccttactatggttatttcatactttggttgcatgaaggctgcccccatgaaagaa
gcaaacgtccgaggacaaggtggcttagcctacccaggtgtgcggacccatgggactctg
gagagcgtgaatgggcccaaggcgggttcaagaggcctgacatcgttggctgacactttc
gaacatgtgatagaagagctgttggatgaggaccagaaagttcggcccaatgaagaaaac
aataaggacgcagacttgtacacgtccagggtgatgctcagtagtcaagtgcctttggag
cctcctcttctctttctgctggaggaatacaaaaattacctagatgctgcaaacatgtcc
atgagggtccggcgccactctgaccctgcccgccgaggggagctgagcgtgtgtgacagt
attagcgagtgggtaacagcggcagacaaaaagactgcagtggacatgtcgggcgggacg
gtcacagtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatacttctacgag
accaagtgcaatcccatgggttacacaaaagaaggctgcaggggcatagacaaaaggcat
tggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatggatagcaaa
aagagaattggctggcgattcataaggatagacacttcttgtgtatgtacattgaccatt
aaaagaggaagatag

DBGET integrated database retrieval system