KEGG   Pongo abelii (Sumatran orangutan): 100447782Help
Entry
100447782         CDS       T01416                                 

Gene name
UGT2A1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100447782 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    100447782 (UGT2A1)
   00500 Starch and sucrose metabolism
    100447782 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100447782 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100447782 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    100447782 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100447782 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    100447782 (UGT2A1)
   00983 Drug metabolism - other enzymes
    100447782 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100447782 (UGT2A1)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100447782 (UGT2A1)
Glycosyltransferases [BR:pon01003]
 Others
  Hydrophobic molecule
   100447782 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 527 aa AA seqDB search
MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPTSNPSLTFEIYKVPFGKEKIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHI
VSQEICDGVLKNQQLMEKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVE
KHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGR
PTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFIQSSGKD
GVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQLYDWIPQNDL
LGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTS
VDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHD
LNWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaaccttctgctgttctcccttcagataagtctcataggaaccactcttggt
gggaatgttttgatttggccaatggaaggtagtcattggctaaatgttaagataattata
gatgagctcattaaaaaggagcataatgtgactgtcctagttgcctctggtgcacttttc
atcacaccaacctctaacccatctctgacatttgaaatatataaggtgccctttggcaaa
gaaaaaatagaaggagtaattaaggactttgttttgacatggctggaaaatagaccatct
ccttcaaccatttggagattctatcaggagatggccaaagtaatcaaggacttccacata
gtgtctcaggagatctgtgatggcgttcttaaaaaccaacagctgatggaaaagctaaag
aaaagcaagtttgaagtcctggtgtccgatccagtatttccttgtggcgatatagtagct
ttaaaacttggaattccatttatgtactccttgaggttttctccagcctcaacagtggaa
aagcactgtgggaaggtaccataccctccttcctatgttcctgctgttttatcagaactc
accgaccaaatgtctttcactgacagaataagaaatttcatctcctaccacctacaggac
tacatgtttgaaactctttggaaatcgtgggattcatactatagtaaagctttaggaaga
cccactacattatgtgagactatggggaaagctgaaatttggttaatccgaacatattgg
gattttgaatttcctcgtccatacttgcctaattttgagttcgttggaggattgcactgc
aaacctgccaaacctttacctaaggaaatggaagaattcatccagagctcaggtaaagat
ggtgttgtggtgttttctctgggatcaatggtcaaaaaccttacagaagaaaaggccaat
cttattgcctcagctcttgcccagattccacagaaggttttatggagatacaaaggaaag
aaaccagccacattaggaaacaatacgcagctctatgattggataccccagaatgatctt
cttggtcatcccaaaaccaaagcttttatcactcatggtggaactaatgggatctatgaa
gctatttaccacggagtccctatggtgggagttcccatgtttgctgatcagcctgataac
attgctcatatgaaggccaaaggagcagctgtggaagtgaacctaaacacaatgacaagt
gtggatttgcttagcgctttgagaacagtcattaatgaaccttcttataaagagaatgct
atgaggttatcaagaattcaccatgatcaacctgtaaagcccctggatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcacctgcggccagctgcccacgac
ctcaactggttccagtaccactctttggatgtaattgggttcttgctggtctgtgtgaca
acagctatatttttggtcatacaatgttgtttgttttcctgtcaaaaatttggtaagata
ggaaagaagaaaaaaagagaatag

DBGET integrated database retrieval system