KEGG   Pongo abelii (Sumatran orangutan): 100447840Help
Entry
100447840         CDS       T01416                                 

Definition
cytochrome P450 2C8-like
Orthology
K17718  
cytochrome P450, family 2, subfamily C, polypeptide 8 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100447840
   00591 Linoleic acid metabolism
    100447840
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100447840
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100447840
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100447840
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100447840
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100447840
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP2 family
   100447840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 490 aa AA seqDB search
MEPFVVLVLCLSFMLLFSLWRQSSGRRKLPPGPTPLPIIGNMLQIDIKDICKSFSNFSKV
YGPVFTVYFGMNPMVVLHGYEAVKEALIDNGEEFSGRGSSPISQRITKGLGIISSNGNRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKLLKNVALT
RSYIREKVKEHQTSLDVTSPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYID
LVPTGVPHAVTTDIQFRNYLIPKGTTIMTLLTSVLHDDKEFPNPKIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttttgtggtcctggtgctctgtctctcttttatgcttctcttttcactctgg
agacagagctctgggagaaggaagttgcctcctggccccactcctcttcctattattgga
aatatgctacagatagatattaaggatatctgcaaatctttcagcaatttttcgaaagtc
tatggtcctgtgttcaccgtgtattttggcatgaatcccatggtggtgttgcatggatat
gaggcagtgaaggaagccctgattgataatggagaggagttttctggaagaggcagttcc
ccaatatctcaaagaattactaaaggacttggaatcatttccagcaatggaaacagatgg
aaggagatccggcgtttctccctcacaaccttgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagctcgctgccttgtggaggagttgagaaaaaccaag
gcctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
gttgttttccagaaacgatttgattataaagatcagaattttctcaccctgatgaaaaga
tttaatgaaaacttcaggattctgaactccccatggatccaggtctgcaataatttccct
ctactcattgattgtttcccaggaactcacaacaaattgcttaaaaatgttgctcttaca
agaagttacattagggagaaagtaaaagaacaccaaacatcactggatgttaccagtcct
cgggactttattgattgcttcctgatcaaaatggagcaggaaaaggacaaccaaaagtca
gaattcaatattgaaaacttggttggcacagtagctgatctatttgttgctggaacagag
acaacaagcactactctgagatatggactcctgctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgatcacgtaattggcagacacaggagcccctgcatgcag
gataggagccacatgccttacactgatgctgtagtgcacgagatccagagatacattgac
cttgtccccaccggtgtgccccatgcagtgaccactgatattcagttcagaaactacctc
atccccaagggcacaaccataatgacattactgacttccgtgctacacgatgacaaagaa
tttcctaatccaaagatctttgaccctggccactttctagataagaatggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacgaatttgtgcgggagaaggactt
gcccgcatggagctatttttatttctaaccacaattttacagaactttaacctgaaatct
gttgatgatttaaagaacctcaatactactgcagttaccaaagggattgtttctctgcca
ccctcgtaccagatctgcttcattcctgtctga

DBGET integrated database retrieval system