KEGG   Pongo abelii (Sumatran orangutan): 100447840Help
Entry
100447840         CDS       T01416                                 

Definition
cytochrome P450 2C8-like
Orthology
K17718  
cytochrome P450, family 2, subfamily C, polypeptide 8 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pon00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:pon00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:pon00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:pon00982]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:pon04726]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:pon05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 490 aa AA seqDB search
MEPFVVLVLCLSFMLLFSLWRQSSGRRKLPPGPTPLPIIGNMLQIDIKDICKSFSNFSKV
YGPVFTVYFGMNPMVVLHGYEAVKEALIDNGEEFSGRGSSPISQRITKGLGIISSNGNRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKLLKNVALT
RSYIREKVKEHQTSLDVTSPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYID
LVPTGVPHAVTTDIQFRNYLIPKGTTIMTLLTSVLHDDKEFPNPKIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttttgtggtcctggtgctctgtctctcttttatgcttctcttttcactctgg
agacagagctctgggagaaggaagttgcctcctggccccactcctcttcctattattgga
aatatgctacagatagatattaaggatatctgcaaatctttcagcaatttttcgaaagtc
tatggtcctgtgttcaccgtgtattttggcatgaatcccatggtggtgttgcatggatat
gaggcagtgaaggaagccctgattgataatggagaggagttttctggaagaggcagttcc
ccaatatctcaaagaattactaaaggacttggaatcatttccagcaatggaaacagatgg
aaggagatccggcgtttctccctcacaaccttgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagctcgctgccttgtggaggagttgagaaaaaccaag
gcctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
gttgttttccagaaacgatttgattataaagatcagaattttctcaccctgatgaaaaga
tttaatgaaaacttcaggattctgaactccccatggatccaggtctgcaataatttccct
ctactcattgattgtttcccaggaactcacaacaaattgcttaaaaatgttgctcttaca
agaagttacattagggagaaagtaaaagaacaccaaacatcactggatgttaccagtcct
cgggactttattgattgcttcctgatcaaaatggagcaggaaaaggacaaccaaaagtca
gaattcaatattgaaaacttggttggcacagtagctgatctatttgttgctggaacagag
acaacaagcactactctgagatatggactcctgctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgatcacgtaattggcagacacaggagcccctgcatgcag
gataggagccacatgccttacactgatgctgtagtgcacgagatccagagatacattgac
cttgtccccaccggtgtgccccatgcagtgaccactgatattcagttcagaaactacctc
atccccaagggcacaaccataatgacattactgacttccgtgctacacgatgacaaagaa
tttcctaatccaaagatctttgaccctggccactttctagataagaatggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacgaatttgtgcgggagaaggactt
gcccgcatggagctatttttatttctaaccacaattttacagaactttaacctgaaatct
gttgatgatttaaagaacctcaatactactgcagttaccaaagggattgtttctctgcca
ccctcgtaccagatctgcttcattcctgtctga

DBGET integrated database retrieval system