KEGG   Pongo abelii (Sumatran orangutan): 100447844Help
Entry
100447844         CDS       T01416                                 

Gene name
RASGRP2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100447844 (RASGRP2)
   04015 Rap1 signaling pathway
    100447844 (RASGRP2)
   04010 MAPK signaling pathway
    100447844 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100447844 (RASGRP2)
   04062 Chemokine signaling pathway
    100447844 (RASGRP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100447844 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 515 aa AA seqDB search
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNLRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKVSLDQYQTEDELYQLSLQREPRSKSSPTS
PTSCTPPPRPPVLEEWTSAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGHISQEEFQII
RGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRH
CKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPTHSHHHRA
FSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaccctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaggacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctccgccttcccagcggagtttgacttgaacccggagctggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaacctgcggcacagcagcctcatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccctgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
tttgtgactcatggctgcactgtggacaaccccgtcctggagcgattcatctccctcttc
aacagcgtctcgcagtgggtgcagctcatgatcctcagcaaacccacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcggagaagctgctgcagctgcagaacttc
aacacactgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaaggtgtctctggatcagtatcagacggag
gatgagctgtaccagctgtccctgcagcgggagccacgctccaagtcctcgccaaccagc
cccacgagttgcaccccaccaccccggcccccggtgctggaggagtggacatcggctgcc
aaacccaagctggatcaggccctcgtggtggagcacatcgagaagatggtggagtctgtg
ttccggaactttgacgtcgatggggatggccacatctcacaggaagaattccagatcatc
cgtgggaacttcccttacctcagcgcctttggggacctcgaccagaaccaggatggctgc
atcagcagggaggagatggtctcctatttcctgcgctccagctccgtgttggggggccgc
atgggcttcgtacacaacttccaggagagcaactccttgcgccctgtcgcctgccgccac
tgcaaagccctgatcctgggcatctacaagcagggcctcaaatgccgagcctgtggtgtg
aactgccacaagcagtgcaaggatcgcctgtcagtcgagtgtcggcgcagggcccagagt
gtgagcctggaggggtctgcaccctcaccctcacccacccacagccaccatcaccgcgcc
ttcagcttctctctgccccgccctggcaggcgaggctccaggcctccagagatccgtgag
gaggaggtacagacggtggaggatggggtgtttgacatccacttgtaa

DBGET integrated database retrieval system