KEGG   Pongo abelii (Sumatran orangutan): 100448016Help
Entry
100448016         CDS       T01416                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S type
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100448016 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100448016 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100448016 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    100448016 (ALOX12)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100448016 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
17
AA seq 672 aa AA seqDB search
MGKYTVRVATRDLLPEGSPNRVQLWLVGEHGEADLGKQLPPVWGKEAEFEIDVPLHLGRL
LTVKLHKHNVLLSLDWFYKWISVQGLGTQGEAFFPCYRWVQGHGIICLPEGTARTLSDDP
QNLFKKYREQELEERRKVYRWGSXKDGLILPIAGNRQPDLPGDERFLEDKDLDFNVSLAK
GLKDLAIKGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPML
LRRSSRLPAHLALPPGMEDLEGQLQKXLQLCFLFLPLXAGSLFEVDFSLLDGVKPNVIIF
KQQYVAAPLVILKLQPDGGLLPMVIQLQPPRHGCPPPLLFLPSDPPMAWLLPKTWVRSSD
FQLHQLQSHLLRXHLIAEVIAVATMKSLPSLHPIYKFLIPHIRYTMEINTRARTQLISDG
GIFDKAVSTGGGGHVQLLRRAAAQLTYRSLCPPDDLADRGLLGLPGALYARDALRLWEII
ARYVEGIVHLFYQRDDVVKGDPELQAWCREITEVGLCQAQDRGFPVSFHSQSQLCHFLTM
CVFTCTAQHAAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQM
AISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEQEITARNEQLDWPYEY
LKPSCIENSVTI
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacggtccgcgtagccaccagggatttgctcccggagggctctcccaac
cgggtgcagctgtggctggtgggcgagcacggggaggcagacctagggaagcagctgcca
ccggtgtggggaaaggaggctgagtttgagatcgacgtccccctgcacctggggcgcctc
ctgacggtgaagctgcacaaacacaacgtgctattgagtctcgactggttctacaagtgg
atctcagtgcagggcctggggacccaaggcgaggcctttttcccctgctaccgctgggtg
cagggccacgggattatctgcctgcccgagggcactgcacggaccttgagtgatgacccc
cagaacctgtttaagaaatatcgggaacaggagctcgaggaaagaaggaaggtgtaccgg
tggggctcctagaaagatgggttaatcctgcctatagcagggaataggcaaccggacctt
cctggggacgagcgattcctcgaggataaggatttagactttaatgtctccctagctaaa
gggttaaaggacttggccattaaggggacactggatttcataaattgtgtgaaaaggctg
gaagatttcaaaaaaatattcccacatggaaagactgtcctggctgagcgggtttatgat
tcttggaagaatgatgccttctttgggtaccagtttctcaatggtgcaaaccccatgctc
ctgaggcgttcttcaaggctcccagcccacctggcgctacctccagggatggaagactta
gaagggcagctccagaaatgactccaactctgttttctattcctgcccctgtaggctgga
tctctgtttgaagtggatttctccttgctggatggagtcaagcctaatgtcatcattttt
aagcagcaatacgtagcagcccctttggtcattctgaagcttcagcctgatggaggactc
ttacccatggtcatccagctccagccacctcgacatggatgtcccccacctctgctcttt
ctgccctcggatccccccatggcctggctcctgcccaagacctgggtccggagctctgat
ttccagctgcaccagttacagtcacatctgctaaggngacacttgattgctgaggttatt
gctgtggctacaatgaaaagcttgcctagcctccatcctatctacaagttcctgatcccc
catatccgctacaccatggaaatcaacacccgggcccggacccaactcatctcagatgga
ggaatttttgataaggcagtgagcacaggtggagggggccatgtgcagttgctccgtcgg
gcggcggctcagctgacctaccgctccctctgtcctcctgacgacctggctgaccggggc
ctgctgggactcccaggtgctctctatgcccgtgatgctttacggctctgggagatcatt
gccaggtatgtggaggggattgtccacctcttctaccaaagggatgatgtagtgaagggg
gaccctgagctgcaggcctggtgtcgggagatcacggaggtggggctgtgccaggcccag
gaccgaggtttccctgtctccttccactcccagagtcaactctgccatttcctcaccatg
tgcgtcttcacgtgcactgcccagcatgccgccatcaaccagggccagctggactggtat
gcctgggtccctaatgccccatgcacaatgcggatgcccccacccaccaccaaggaagat
gtgacgatggccacagtgatggggtcactacctgatgtccggcaggcctgtcttcaaatg
gccatctcatggcatctgagtcgccgccagccagacatggtgcctctggggcatcacaaa
gaaaaatatttctcaggccccaagcccaaagctgtgctaaaccaattccgaacagatttg
gaaaagctggaacaggagattacagcccggaatgagcaacttgactggccctatgaatat
ctgaagcccagctgcatagagaacagtgtcaccatctga

DBGET integrated database retrieval system