KEGG   Pongo abelii (Sumatran orangutan): 100448195Help
Entry
100448195         CDS       T01416                                 

Gene name
PDIA4
Definition
protein disulfide isomerase family A, member 4
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pon04141]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:pon04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 936 aa AA seqDB search
MRPRKACLLLLLLGLAQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEEDLEVKE
ENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDNDPPIPVAKI
DATSASMLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTL
ALTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDAIAE
TDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
KDGDDVIIIGVFKGESDPAYQQYQDAGDTXEKNYKFHHTSQSTEIAKFLKVSQGQLVVMQ
PEKFQSKYEPRSHVMDVQGLELLFQPILPTTQVFCRRPVVCVCRRDRSWGSRTPGRSWGL
TELHLVLPEQVAATLCPSLAGNYQSPSSACSTVEIGLQRSELYPPPWTPQLLVGSRAEIG
VKGTFQILLAHSVRTLAVWPVGSHGTWRRGRAHGQESRGPAPERGSTLERTTLNLSGPHV
LCLLSQSLVLSLLLKTHKILGPKRGPVMSLGGHRSRESDTASRCVSACSRKGVCGFSVDA
SRSVQSLSVGHIAAAPQFLRRFPAELIPSKSPLPRSPSNIVLKNNGGEMVGPLTCSLFEX
RAPPRNSAIKDFVLKYALPLVGHRKASNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRS
KVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSD
TLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKDLRLHCDCDPKKDVLIEFYAPWC
GHCKQLEAVYNSLAKKYKGQKGPGLIIAKMDATAQPTSPSDRYQGGGVPPHHLLLPPVGT
KRTPVKFEGGDRDLEHLSKFIEEHATXTEQDQGKSF
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggaaagcctgcctgctcctgctgctcctggggctggcgcagctgctggcc
gtggcgggtgccgagggcccggacgaagattcttctaacagagaaaatgccattgaggat
gaagaggaggaggaggaggaagatgatgatgaggaagaagaggacttggaagttaaggaa
gaaaatggtgtcttggtcctaaatgatgcaaactttgataattttgtggctgacaaagac
acagtgctgctggagttttatgctccatggtgtggacattgcaagcagtttgctccggaa
tatgaaaaaattgccaacatattaaaggataatgatcctcccattcctgttgccaagatc
gatgcaacctcagcgtctatgctggccagcaggtttgatgtgagtggctaccccaccatc
aagatccttaagaaggggcaggctgtagactacgagggctccagaacccaggaagaaatt
gttgccaaggtcagagaagtctcccagcccgactggacgcctccaccagaagtcacgctt
gcgttgaccaaagagaactttgatgaagttgtgaatgatgcagatatcattctggtggag
ttttacgccccatggtgtggacactgcaagaaacttgcccccgagtatgagaaggccgcc
aaggagctcagcaagcgttctcctccaattcccctggcgaaggtcgacgccatcgcagaa
acagacctggccaagaggttcgatgtctctggctaccccaccctgaaaattttccgcaaa
ggaaggccttatgactacaacggcccacgagaaaaatacggaatcgttgactacatgatc
gagcagtccgggcctccctccaaggagattctgaccttgaagcaggtccaggagttcctg
aaggatggagatgatgtcatcatcatcggggtctttaagggggagagtgacccagcctac
cagcaataccaggatgccggtgatacctgagagaagaattacaaatttcaccacacttct
caaagcacagaaatagcaaagttcttgaaagtctcccaggggcagttggttgtaatgcag
cctgagaaattccagtccaagtatgagccccggagccacgtgatggacgtccagggtctg
gaactccttttccagcccattctccccaccacacaggttttctgcaggcggcccgtggtc
tgcgtttgccggagggacaggtcctggggctcccgcacacctggcaggtcctggggcctg
acagagctccacttggttttgccagaacaggttgctgccaccctttgtccctccctggca
ggcaattaccagtctccctccagcgcctgttccactgtggagattgggctgcagagaagt
gagctctaccccccaccctggaccccacagctcctggtgggaagcagagctgagattggg
gtgaaggggactttccagatcctactggcccatagtgtcaggaccctggctgtttggcct
gtgggctctcatgggacctggaggagggggcgtgcacatggacaggaatcccgggggcct
gcaccagaacgtggcagtaccttggagagaaccaccctgaatctttctggtccccacgtc
ctctgtctcctttctcagtctttagtcctgtccctccttctcaagacgcataagatcctg
ggcccgaagaggggtcctgtgatgagcttggggggccatcgatcccgagaatcagacaca
gcttctaggtgtgtgagtgcatgttccaggaaaggggtctgtggcttttcagtagacgct
tcaagatctgtgcagtccttgtctgttgggcacattgctgctgctccccagttcctccgg
cgtttccctgctgaactgatcccttcaaagtcgccactcccccgaagtccctcgaacatt
gtactcaagaacaatggtggggagatggtgggccccctcacctgttccctctttgaagnc
agggctccacccaggaactcggccatcaaggacttcgtgctgaagtatgccctgcccctg
gttggacaccgcaaggcgtcaaacgacgctaagcgctacaccaggcgccccctggtggtc
gtttactacagtgtggacttcagctttgattacagagctgcgactcagttttggcggagc
aaagtcctagaggtggccaaggacttccctgagtacacctttgccattgcggacgaagag
gactatgctggggaggtgaaggacctgggactcagcgagagtggggaggatgtcaatgcc
gccatccttgacgagagtgggaagaagttcgccatggagccggaggagtttgactccgac
accctccgcgagtttgtcactgctttcaaaaaaggaaaactgaagccagtcatcaaatcc
cagccagtgcccaagaacaacaagggacccgtcaaggttgtggtgggaaaagaccttcga
ctccattgtgactgtgaccccaagaaggacgtcctcatcgagttctacgcgccatggtgc
gggcactgcaagcagctagaggccgtgtacaacagcctggccaagaagtacaagggccaa
aagggtcctggtcttattatcgccaagatggacgccactgcccaaccgacatcccccagc
gaccgctatcaaggtggaggggttcccccacaccatctactgttgcccccagtggggaca
aaaagaaccccagttaaatttgagggtggagacagagatctggagcatttgagcaagttt
atagaagaacatgccacaaanactgagcaggaccaaggaaagagcttttga

DBGET integrated database retrieval system