KEGG   Pongo abelii (Sumatran orangutan): 100448195Help
Entry
100448195         CDS       T01416                                 

Gene name
PDIA4
Definition
(RefSeq) protein disulfide-isomerase A4 isoform X1
  KO
K09582  protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04141  Protein processing in endoplasmic reticulum
pon04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100448195 (PDIA4)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100448195 (PDIA4)
Enzymes [BR:pon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100448195 (PDIA4)
Chaperones and folding catalysts [BR:pon03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100448195 (PDIA4)
Membrane trafficking [BR:pon04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100448195 (PDIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 Calsequestrin AhpC-TSA Thioredoxin_4 TraF
Motif
Other DBs
NCBI-GeneID: 100448195
NCBI-ProteinID: XP_024105432
Position
7
AA seq 646 aa AA seqDB search
MRPRKACLLLLLLGLAQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEEDLEVKE
ENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDNDPPIPVAKI
DATSASMLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTL
ALTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDAIAE
TDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
KDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQP
EKFQSKYEPRSHVMDVQQGSTQDSAIKDFVLKYALPLVGHRKASNDAKRYTRRPLVVVYY
SVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAIL
DESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIV
MDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDIPSDRYKVEG
FPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggaaagcctgcctgctcctgctgctcctggggctggcgcagctgctggcc
gtggcgggtgccgagggcccggacgaagattcttctaacagagaaaatgccattgaggat
gaagaggaggaggaggaggaagatgatgatgaggaagaagaggacttggaagttaaggaa
gaaaatggtgtcttggtcctaaatgatgcaaactttgataattttgtggctgacaaagac
acagtgctgctggagttttatgctccatggtgtggacattgcaagcagtttgctccggaa
tatgaaaaaattgccaacatattaaaggataatgatcctcccattcctgttgccaagatc
gatgcaacctcagcgtctatgctggccagcaggtttgatgtgagtggctaccccaccatc
aagatccttaagaaggggcaggctgtagactacgagggctccagaacccaggaagaaatt
gttgccaaggtcagagaagtctcccagcccgactggacgcctccaccagaagtcacgctt
gcgttgaccaaagagaactttgatgaagttgtgaatgatgcagatatcattctggtggag
ttttacgccccatggtgtggacactgcaagaaacttgcccccgagtatgagaaggccgcc
aaggagctcagcaagcgttctcctccaattcccctggcgaaggtcgacgccatcgcagaa
acagacctggccaagaggttcgatgtctctggctaccccaccctgaaaattttccgcaaa
ggaaggccttatgactacaacggcccacgagaaaaatacggaatcgttgactacatgatc
gagcagtccgggcctccctccaaggagattctgaccttgaagcaggtccaggagttcctg
aaggatggagatgatgtcatcatcatcggggtctttaagggggagagtgacccagcctac
cagcaataccaggatgccgctaacaacctgagagaagattacaaatttcaccacactttc
agcacagaaatagcaaagttcttgaaagtctcccaggggcagttggttgtaatgcagcct
gagaaattccagtccaagtatgagccccggagccacgtgatggacgtccagcagggctcc
acccaggactcggccatcaaggacttcgtgctgaagtatgccctgcccctggttggccac
cgcaaggcgtcaaacgacgctaagcgctacaccaggcgccccctggtggtcgtctactac
agtgtggacttcagctttgattacagagctgcgactcagttttggcggagcaaagtccta
gaggtggccaaggacttccctgagtacacctttgccattgcggacgaagaggactatgct
ggggaggtgaaggacctgggactcagcgagagtggggaggatgtcaatgccgccatcctt
gacgagagtgggaagaagttcgccatggagccggaggagtttgactccgacaccctccgc
gagtttgtcactgctttcaaaaaaggaaaactgaagccagtcatcaaatcccagccagtg
cccaagaacaacaagggacccgtcaaggttgtggtgggaaagaccttcgactccattgtg
atggaccccaagaaggacgtcctcatcgagttctacgcgccatggtgcgggcactgcaag
cagctagagcccgtgtacaacagcctggccaagaagtacaagggccaaaagggcctggtc
atcgccaagatggacgccactgccaacgacatccccagcgaccgctataaggtggagggc
ttccccaccatctactttgcccccagtggggacaaaaagaacccagttaaatttgagggt
ggagacagagatctggagcatttgagcaagtttatagaagaacatgccacaaaactgagc
aggaccaaggaagagctttga

DBGET integrated database retrieval system