KEGG   Pongo abelii (Sumatran orangutan): 100448282Help
Entry
100448282         CDS       T01416                                 

Gene name
EIF4E
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100448282 (EIF4E)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100448282 (EIF4E)
   04151 PI3K-Akt signaling pathway
    100448282 (EIF4E)
   04150 mTOR signaling pathway
    100448282 (EIF4E)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100448282 (EIF4E)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100448282 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100448282 (EIF4E)
Translation factors [BR:pon03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100448282 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 132 aa AA seqDB search
MPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDY
SDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTAT
KSGSTTKNRFVV
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcctggctgtgactactcactttttaaggatggtattgagcctatgtgggaagatgag
aaaaacaaacggggaggacgatggctaattacattgaacaaacagcagagacgaagtgac
ctcgatcgcttttggctagagacacttctgtgccttattggagaatcttttgatgactac
agtgatgatgtatgtggcgctgttgttaatgttagagctaaaggtgataagatagcaata
tggactactgaatgtgaaaacagagaagctgttacacatatagggagggtatacaaggaa
aggttaggacttcctccaaagatagtgattggttatcagtcccatgcagacacagctact
aagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system