KEGG   Pongo abelii (Sumatran orangutan): 100448292Help
Entry
100448292         CDS       T01416                                 

Gene name
ACR
Definition
acrosin
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     100448292 (ACR)
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100448292 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 365 aa AA seqDB search
MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSL
QIFTYNSHRYHACGGSLLNSRWVLTAAHCFVGKNKVHDWRLVFGAKEITYGNNKPVKAPV
QERYVEKIIIHEKYNSATEGDDIALVKITPPISCGSFIGPGCLPHFKAGLPRGSQSCWVA
GWGYIEEKAPRPSSMLMEARVDLIDLDLCNSTQWYNGRVQPTNMCAGYPVGKIDTCQGDS
GGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNALHMIQPA
TPPPPTTRPPPIQPPFSHPISAHLPWYFQPPPRTLAQPRPPPPPPPPPPXXXXLVINRPS
ETIPQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagatgctaccaactgccattctgctggtcttggcggtgtccgtagttgctaaa
gataacgccacgtgtgatggcccctgtgggttacggttcaggcagaacccacaaggtggt
gtccgcatcgtcggcgggaaggctgcacagcatggggcctggccctggatggtcagcctc
cagatcttcacgtacaacagccacaggtaccacgcatgtggaggcagcttgctgaattca
cgatgggtgctcactgctgctcactgcttcgttggcaaaaataaagtgcatgactggaga
ctggttttcggagcaaaggaaattacgtatgggaacaataaaccagtaaaggcgcctgtg
caagagagatatgtggagaaaatcatcattcatgaaaaatacaactctgcgacagaggga
gatgacattgccctcgtgaagatcacccctcccatttcgtgtgggagcttcattgggccg
ggctgcctgccccactttaaggcaggcctccccagaggctcccagagctgctgggtggct
ggctggggatatatagaagagaaagcccccaggccatcatctatgctgatggaggcacgt
gtggatctcatcgacctggacttgtgtaactcgacccagtggtacaatgggcgcgttcag
ccaaccaatatgtgcgcgggctatcctgtaggcaagatcgacacctgccagggggacagc
ggcgggcctctcatgtgcaaagacagcaaggaaagcgcctatgtggtcgtgggaatcaca
agctggggggtaggctgtgcccgtgccaagcgccccggaatctacacggccacctggccc
tatctgaactggatcgcctccaagattggttctaatgctctgcatatgattcaaccggcc
acccctccacctcccaccactcgaccgcccccgattcaaccccccttctcccaccctatc
tctgctcaccttccttggtatttccaaccgccccctcgaacacttgcccagccccgaccc
ccacctccacccccgcccccacccccacnnnnnnnnnncctggttatcaacagacccagt
gagacgatccctcagtag

DBGET integrated database retrieval system