KEGG   Pongo abelii (Sumatran orangutan): 100448382Help
Entry
100448382         CDS       T01416                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04015  Rap1 signaling pathway
pon04218  Cellular senescence
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon05014  Amyotrophic lateral sclerosis (ALS)
pon05145  Toxoplasmosis
pon05164  Influenza A
pon05167  Kaposi's sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05418  Fluid shear stress and atherosclerosis
Module
pon_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100448382 (MAP2K6)
   04010 MAPK signaling pathway
    100448382 (MAP2K6)
   04668 TNF signaling pathway
    100448382 (MAP2K6)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100448382 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100448382 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100448382 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    100448382 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100448382 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    100448382 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100448382 (MAP2K6)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100448382 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    100448382 (MAP2K6)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100448382 (MAP2K6)
   05169 Epstein-Barr virus infection
    100448382 (MAP2K6)
   05145 Toxoplasmosis
    100448382 (MAP2K6)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100448382 (MAP2K6)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE7 family
   100448382 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 DUF4344 Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 100448382
NCBI-ProteinID: XP_002827807
Ensembl: ENSPPYG00000008579
UniProt: H2NUJ7
Position
17
AA seq 334 aa AA seqDB search
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaattccaaaagaagcattt
gaacaacctcagaccagttccacaccacctcgagatttagactccaaggcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctggagcctataatggaactggga
cgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcgggcagatcatggca
gtgaagcggatccgagctacagtaaatagccaggaacagaaacggctactgatggatttg
gatatttccatgaggacggtggactgtccattcactgtcaccttttatggcgcactgttt
cgggagggtgatgtgtggatctgcatggagctcatggatacatcactagataaattctac
aaacaagttattgataaaggccagacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcattagaacatttacacagtaagctgtctgtcattcacagagacgtc
aagccttctaatgtactcattaatgctctcggtcaagtgaagatgtgcgattttggaatc
agtggctacttggtggactctgttgctaaaacaattgatgcaggttgcaaaccatacatg
gcccctgaaagaataaacccagagctcaaccagaagggatacagtgtgaagtctgacatt
tggagtctgggcatcacaatgattgagttggccatccttcgatttccctatgattcatgg
ggaactccatttcagcagctcaaacaggtggtagaggagccatcgccacaactcccagca
gacaagttctctgcagagtttgttgactttacctcacagtgcttaaagaagaattccaaa
gaacggcctacatacccagagctaatgcaacatccatttttcaccctacatgaatccaaa
ggaacagatgtggcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system