KEGG   Pongo abelii (Sumatran orangutan): 100448476Help
Entry
100448476         CDS       T01416                                 

Gene name
ACACB
Definition
(RefSeq) acetyl-CoA carboxylase 2
  KO
K01946  
acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100448476 (ACACB)
   00640 Propanoate metabolism
    100448476 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100448476 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100448476 (ACACB)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100448476 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100448476 (ACACB)
   04922 Glucagon signaling pathway
    100448476 (ACACB)
   04920 Adipocytokine signaling pathway
    100448476 (ACACB)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100448476 (ACACB)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     100448476 (ACACB)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100448476 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100448476 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
12
AA seq 2458 aa AA seqDB search
MVLLLCLSCLIFSCLTFSWLKIWGKMTDSKPITKSKSEANFIPSQEPFPDSDNSGETPQR
NGEGHSLPNTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
GTQGLEAPDTDGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSSDEDSV
ASSSRESTRKGSRASLGALSLEAYLITGEAETRVPTMRPSMSGLHLVKRGREHKKLDLHR
DFTVASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVT
PEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDVAKRIPVQAVWAGWGHASENPKL
PELLCKNGVAFLGPPSEAMWALGDKIASTIVAQTLQVPTLPWSGSGLTVEWTEDDLQQGK
RISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQV
QSEIPGSPIFLMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAP
LAIFEFMEQCAVRLAKTVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNL
PAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPISFETPSIPPLARGHVIATRITSENPDE
GFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQFGHCFSWGENREEAISNMVVA
LKELSIRGDFRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQAEKPDIMLGVVCGAL
NVADARFRTCMTDFLHSLERGQVLPADSLLNLVDVELIYGGVKYILKVARQSLTMFVLIM
NGCHIEIDAHRLNDGGLLLSYNGNSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSP
SAGKLTQYTVEDGGHVEAGSSYAEMEVMKMIMTLNVQESGRVKYIKRPGAVLEAGCVVAR
LELDDPSKVHPAEPFTGELPAQQTLPILGEKLHQVFHSVLENLTNVMSGFCLPEPIFSIK
LKEWVQKLMMTLRHPSLPLLELQEIMTSVAGRIPAPVEKSVRRVMAQYASNITSVLCQFP
SQQIATILDCHAATLQRKADREVFFINTQSIVQLVQRYRSGIRGYMKTVVLDLLRRYLRV
EHHFQQAHYDKCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLIDELCGPDPSLSD
ELTSILNELTQLSKSEHCKVALRARQILIASHLPSYELRHNQVESIFLSAIDMYGHQFCP
ENLKKLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRQLPDGTCV
VEFQFMLPSSHPNRMTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTR
NFDEVISCFANVPKDTPLFSEARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVP
ILRTFVQSKKNILVDYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPALAFQL
ELNRMRNFDLTAVPCANHKMHLYLGAAKVKEGVEVTDHRFFIRAIIRHSDLITKEASFEY
LQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPFKIEESVRYMVMRYGS
RLWKLRVLQAEVKINIRQTTTGSAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSF
GNKQGPQHGMLINTPYVTKDLLQAKRFQAQSLGTTYIYDFPEMFRQALFKLWSSPDKYPK
DILTYTELVLDSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIG
SFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFK
YLYLTPQDYTRISSLNSVHCKHIEEGGESRYMITDIIGKDDGLGVENLRGSGMIAGESSL
AYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQL
GGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPIDREIEFLPSR
APYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVE
TRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAIKDFNREKLPLMIFANWRGF
SGGMKDMYDQVLKFGAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYA
DKESRGGVLEPEGTVEIKFRKKDLIKSMRRLDPAYKKLMEQLGEPDLSDKDRKDLEGRLK
AREDLLLPIYHQVAVQFADFHDTPGRMLEKGVISDILEWKTARTFLYWRLRRLLLEDQVK
QEILQASGELSHVHIQSMLRRWFVETEGAVKAYLWDNNQVVVQWLEQHWQAGDGPRSTIR
ENITYLKHDSVLKTIRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLSTMDSPAST
NT seq 7377 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgcttctttgtctatcttgtctgattttctcctgtctgaccttttcctggtta
aaaatctgggggaaaatgacggactccaagccgatcaccaagagtaaatcagaagcaaac
ttcatcccgagccaggagccctttccagactctgataactcaggggagacaccacagaga
aatggggagggccactctctgcccaacacccccagccaggccgagccagcctcccacaaa
ggccccaaagatgccggtcggcggagaaactccctaccaccctcccaccagaagccccca
aggaaccccctttcttccagtgacgcagcaccctccccagaacttcaagccaatgggact
gggacacaaggtctggaggccccagataccgatggcctgtcctcctcagccaggccccag
ggccagcaagctggctccccctccaaagaagacaagaagcaggcaaacatcaagaggcag
ctgatgaccaacttcatcctgggctcttttgatgactactcctccgacgaggactctgtt
gccagctcatctcgtgagtctacccggaagggcagccgggccagcttgggggccctgtcc
ctggaggcttatctgatcacaggtgaagctgagacccgcgtccccactatgaggccgagc
atgtcgggactccacctggtgaagaggggacgggaacacaagaagctggacctgcacaga
gactttaccgtggcttctcccgctgagtttgtcacacgctttgggggggatcgggtcatc
gagaaggtgcttattgccaacaatgggatcgccgctgtgaagtgcatgcgctccatccgc
aggtgggcctatgagatgttccgcaatgagcgggccatccggtttgttgtgatggtgacc
cccgaggaccttaaggccaacgcagagtacatcaagatggcagatcattacgtccccgtc
ccaggagggcccaataacaacaactatgccaacgtggagctgattgtggacgttgccaag
agaatccccgtgcaggcggtgtgggctggctggggccatgcttcagaaaaccctaaactt
ccggagctgctgtgcaagaatggagttgctttcttaggccctcccagtgaggccatgtgg
gccttaggagataagatcgcctccaccattgtcgcccagacgctacaggtcccaaccctg
ccctggagtggaagcggcctgacagtggagtggacagaagatgatctgcagcagggaaaa
agaatcagtgtcccagaagatgtttatgacaagggttgtgtgaaagacgtagatgagggc
ttggaggcagcagaaagaattggttttccattgatgatcaaagcttctgaaggtggcgga
gggaagggaatccggaaggctgagagtgcggaggacttcccgatccttttcagacaagta
cagagtgagatcccaggctcgcccatctttctcatgaagctggcccagcacgcccgtcac
ctggaagttcagatcctcgctgaccagtatgggaatgctgtgtctctgtttggtcgcgac
tgctccatccagcggcggcatcagaagatcgttgaggaagcaccggccaccatcgccccg
ctggccatattcgagttcatggagcagtgtgccgtccgcctggccaagaccgtgggctat
gtgagtgcagggacagtggaatacctctatagccaggacggcagcttccacttcttggag
ctgaatcctcgcttgcaggtggaacatccctgcacagaaatgattgctgacgtcaatctg
ccggccgcccagctacagatcgccatgggcgtgccactgcaccggctgaaggatatccgg
cttctgtacggagagtcaccatggggagtgactcccatttcttttgaaaccccctcaatc
cctcccctcgcccgaggccacgtcattgccaccagaatcaccagcgaaaacccagatgag
ggttttaagccgagctccgggactgtccaggaactgaatttccggagcagcaagaacgtg
tggggttacttcagcgtggccgctactggaggcctgcacgagtttgcggattcccagttt
gggcactgcttctcctggggagagaaccgggaagaggccatttcgaacatggtggtggct
ttgaaggaactgtccatccgaggcgactttaggactaccgtggaatacctcattaacctc
ctggagaccgagagcttccagaacaacgacattgacaccgggtggttggactacctcatt
gctgagaaagtgcaggcggagaaaccggatatcatgcttggggtggtatgcggggccttg
aacgtggccgatgcgaggttcagaacgtgcatgacagatttcttacactccctggaaagg
ggccaggtcctcccagcggattcgctactgaacctcgtagatgtggaattaatttacgga
ggtgttaagtatattctcaaggtggcccggcagtctctgaccatgtttgttctcatcatg
aatggctgccacatcgagattgacgcccaccggctgaatgatggggggctcctgctctcc
tacaatgggaacagctacaccacctacatgaaggaagaggttgacagttaccgaattacc
atcggcaataagacgtgtgtgtttgagaaggagaacgatcctacggtcctgagatccccc
tcagctgggaagctgacacagtacacagtggaggatgggggccacgttgaggctgggagc
agctacgctgagatggaggtgatgaagatgatcatgaccctgaacgtgcaggaaagtggc
cgggtgaagtacatcaagcgtccaggtgctgtgctggaagcaggctgcgtggtggccagg
ctggagcttgatgacccttctaaagtccacccggctgaaccgttcacaggagaactccct
gcccagcagacactgcccatcctcggagaaaaactgcaccaggtcttccacagcgtcctg
gaaaacctcaccaacgtcatgagtggcttttgtctgccagagcccatttttagcataaag
ctgaaggagtgggtgcagaagctcatgatgaccctccggcacccgtcactgccgctgctg
gagctgcaggagatcatgactagcgtggcaggccgcatccctgcccccgtggagaagtcg
gtccgcagagtgatggcccagtatgccagcaacatcacctcggtgctgtgccagttcccc
agccagcagatagccaccatcctggactgccacgcagccaccctgcagcggaaggccgat
cgagaggtcttcttcatcaacacccagagcatcgtgcagttggtccagagataccgcagc
gggatccgcggctatatgaaaacagtggtgttggatctcctgagaagatacttgcgtgtt
gagcaccattttcagcaagcccactacgacaagtgtgtgataaacctcagggagcagttc
aagccagacatgtcccaggtgttggactgcatcttctcccacgcgcaggtggccaagaag
aaccagttggtgatcatgttgatcgatgagctgtgtggcccagacccttccctgtcggac
gagctgacctccatcctcaacgagctcactcagctgagcaaaagcgagcactgcaaagtg
gccctcagagcccggcagatcctgattgcctcccatctcccctcctacgagctgcggcat
aaccaggtggagtccattttcctgtctgccattgacatgtacggccaccagttctgcccc
gagaacctcaagaaattaatactttcggaaacaaccatctttgacgtcctgcctactttc
ttctatcatgctaacaaagtcgtgtgcatggcgtccttggaggtttacgtgcggaggggc
tacatcgcctatgagttaaacagcctgcagcaccggcagctcccggacggtacctgtgtg
gtagaattccagttcatgctgccctcctcccacccaaaccggatgactgtgcccatcagt
atcaccaaccctgacctgctgaggcacagcacagagctcttcatggacagcggcttctcc
ccactgtgccagcgcatgggagccatggtagccttcaggagattcgaggacttcaccaga
aattttgatgaagtcatctcttgctttgccaacgtgcccaaagacacccccctcttcagc
gaggcccgcacctccctgtactccgaggatgactgcaagagcctcagagaagagcccatc
cacattctgaatgtgtccatccagtgtgcagaccacctggaggatgaggcactggtgccg
attttacggacgtttgtacagtccaagaaaaatatccttgtggattatggactccgacga
atcacattcttgattgcccaagagaaagaatttcccaagtttttcacattcagagcaaga
gatgagtttgcagaagatcgcatttaccgtcacttggaacctgccctggccttccagctg
gaactcaaccggatgcgtaacttcgatctgaccgccgtgccctgtgccaaccacaagatg
cacctttacctgggtgctgccaaggtgaaggaaggggtggaagtgacggaccataggttc
ttcatccgcgccatcatcaggcactccgacctgattacaaaggaagcctccttcgaatac
ctgcagaacgagggtgagcggctgctcctggaggccatggacgagctggaggtggcgttc
aataacaccagcgtgcgaaccgactgcaaccacatcttcctcaacttcgtgcccactgtc
atcatggaccccttcaagatcgaggagtccgtgcgctacatggttatgcgctacggcagc
cggttgtggaaactccgcgtgctgcaggctgaggtcaagatcaacatccgccagaccacc
accggcagtgccgttcccatccgcctgttcatcaccaatgagtcgggctactacctggac
atcagcctctacaaagaagtgactgactccagatccggaaatatcatgtttcactccttc
ggcaacaagcaagggccccagcacgggatgctgatcaatactccctacgtcaccaaggat
ctgctccaggccaagcgattccaggcccagtccctgggaaccacctacatctatgacttc
ccggaaatgttcaggcaggctctctttaaactgtggagctccccagacaagtatcccaaa
gacatcctgacatacactgaattagtgttggactctcagggccagctggtggagatgaac
cgacttcctggtggaaatgaggtgggcatggtggccttcaaaatgaggtttaagacccag
gagtacccggaaggacgggacgtgatcgtcatcggcaacgacatcacctttcgcattgga
tcttttggccctggggaggaccttctgtacctgcgggcatccgagatggcccgggcagag
ggcattcccaaaatctacgtggcagccaacagtggcgcccgtattggcatggcagaggag
atcaaacacatgttccacgtggcttgggtggacccagaagacccccacaaaggatttaaa
tacctgtacctgactccccaagactacaccagaatcagctccctgaactccgtccactgt
aaacacatcgaggaaggaggagaatccagatacatgatcacggatatcatcgggaaggat
gatggcttgggcgtggagaatctgaggggctcaggcatgattgctggggagtcctctctg
gcttacgaagagatcgtcaccattagcttggtgacctgccgagccattgggattggggcc
tacttggtgaggctgggccagcgagtgatccaggtggagaactcccacatcatcctcaca
ggagcaagtgctctcaacaaggtcctgggaagagaggtctacacatccaacaaccagctg
ggtggcgttcagatcatgcattacaatggtgtctcccacatcaccgtgccagatgacttt
gagggggtttataccatcctggagtggctgtcctatatgccaaaggataatcacagccct
gtccctatcatcacaccaactgaccccattgacagagaaattgaattcctcccatccaga
gctccctacgacccccggtggatgcttgcaggaaggcctcacccaactctgaagggaacg
tggcagagcggattctttgaccacggcagtttcaaggaaatcatggcaccctgggcacag
accgtggtaacaggacgagcaaggcttggggggattcccgtgggagtgattgctgtggag
acacggactgtggaggtggcagtccctgcagaccctgccaacctggattctgaggccaag
ataattcagcaggcaggacaggtgtggttcccagactcagcctacaaaactgcccaggcc
atcaaggacttcaaccgggagaagttgcccctgatgatctttgccaactggagggggttc
tctggtggcatgaaagacatgtatgaccaggtgctgaagtttggagcctacatcgtggac
ggccttagacaatacaaacagcccatcctgatctatatcccaccctatgcggagctccgg
ggaggctcctgggtggtcatagacgccaccatcaacccactgtgcatagaaatgtatgcg
gacaaagagagcagggggggtgttctggaaccagaggggacagtggagattaagttccga
aagaaagatctgataaagtccatgagaaggctcgatccagcttacaagaagctcatggaa
cagctaggggaacctgatctctccgacaaggaccgcaaggacctggagggccggctgaaa
gctcgcgaggacctgctgctccccatctaccaccaggtggcggtgcagttcgccgacttc
cacgacacgcccggccggatgctggagaagggcgtcatatctgacatcctggagtggaag
accgcacgcaccttcctatattggcgtctgcgccgcctcctcctggaggaccaggtcaag
caggagatcctgcaggccagtggggagctgagtcacgtgcatatccagtccatgctgcgc
cgctggttcgtggagacggagggggctgtcaaggcctacttgtgggacaacaaccaggtg
gttgtgcagtggctggaacagcactggcaggcgggggatggcccgcgctccaccatccgt
gagaacatcacgtacctgaagcacgactctgtcctcaagaccatccgaggcctggttgaa
gaaaaccccgaggtggccgtggactgtgtgatatacctgagccagcacatcagcccagct
gagcgggcgcaggtcgttcacctgctgtctaccatggacagcccggcctccacctga

DBGET integrated database retrieval system