KEGG   Pongo abelii (Sumatran orangutan): 100448476Help
Entry
100448476         CDS       T01416                                 

Gene name
ACACB
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pon01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pon00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pon00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:pon00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:pon04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 1124 aa AA seqDB search
MTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTRNFDEVISCFANVPK
DTPLFSEARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVPILRTFVQSKKNILV
DYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPALAFQLELNRMRNFDLTAVP
CANHKMHLYLGAAKVKEGVEVTDHRFFIRAIIRHSDLITKEASFEYLQNEGERLLLEAMD
ELEVAFNNTSVRTDCNHIFLNFVPTVIMDPFKIEESVRYMVMRYGSRLWKLRVLQAEVKI
NIRQTTTGSAIPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSFGNKQGPQHGMLINT
PYVTKDLLQAKRFQAQSLGTTYIYDFPEMFRQALFKLWSSPDKYPKDILTYTELVLDSQG
QLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIGSFGPGEDLLYLRAS
EMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFKYLYLTPQDYTRISS
LNSVHCKHIEEGGESRYMITDIIGKDDGLGVENLRGSGMIAGESSLAYEEIVTISLVTCR
AIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQLGGVQIMHYNGVSHI
TVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPIDREIEFLPSRAPYDPRWMLAGRPH
PTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVETRTVEVAVPADPAN
LDSEAKIIQQAGQVWFPDSAYKTAQAIKDFNREKLPLMIFANWRGFSGGMKDMYDQVLKF
GAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYADKESRGGVLEPEGT
VEIKFRKKDLIKSMRRLDPAYKKLMEQLGEPDLSDKDRKDLEGRLKAREDLLLPIYHQVA
VQFADFHDTPGRMLEKGVISDILEWKTARTFLYWRLRRLLLEDQVKQEILQASGELSHVH
IQSMLRRWFVETEGAVKAYLWDNNQVVVQWLEQHWQAGDGPRSTIRENITYLKHDSVLKT
IRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLSTMDSPAST
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcccatcagtatcaccaaccctgacctgctgaggcacagcacagagctcttc
atggacagcggcttctccccactgtgccagcgcatgggagccatggtagccttcaggaga
ttcgaggacttcaccagaaattttgatgaagtcatctcttgctttgccaacgtgcccaaa
gacacccccctcttcagcgaggcccgcacctccctgtactccgaggatgactgcaagagc
ctcagagaagagcccatccacattctgaatgtgtccatccagtgtgcagaccacctggag
gatgaggcactggtgccgattttacggacgtttgtacagtccaagaaaaatatccttgtg
gattatggactccgacgaatcacattcttgattgcccaagagaaagaatttcccaagttt
ttcacattcagagcaagagatgagtttgcagaagatcgcatttaccgtcacttggaacct
gctctggccttccagctggaactcaaccggatgcgtaacttcgatctgaccgccgtgccc
tgtgccaaccacaagatgcacctttacctgggtgctgccaaggtgaaggaaggggtggaa
gtgacggaccataggttcttcatccgcgccatcatcaggcactccgacctgattacaaag
gaagcctccttcgaatacctgcagaacgagggtgagcggctgctcctggaggccatggac
gagctggaggtggcgttcaataacaccagcgtgcgaaccgactgcaaccacatcttcctc
aacttcgtgcccactgtcatcatggaccccttcaagatcgaggagtccgtgcgctacatg
gttatgcgctacggcagccggttgtggaaactccgcgtgctgcaggctgaggtcaagatc
aacatccgccagaccaccaccggcagtgccattcccatccgcctgttcatcaccaatgag
tcgggctactacctggacatcagcctctacaaagaagtgactgactccagatccggaaat
atcatgtttcactccttcggcaacaagcaagggccccagcacgggatgctgatcaatact
ccctacgtcaccaaggatctgctccaggccaagcgattccaggcccagtccctgggaacc
acctacatctatgacttcccggaaatgttcaggcaggctctctttaaactgtggagctcc
ccagacaagtatcccaaagacatcctgacatacactgaattagtgttggactctcagggc
cagctggtggagatgaaccgacttcctggtggaaatgaggtgggcatggtggccttcaaa
atgaggtttaagacccaggagtacccggaaggacgggacgtgatcgtcatcggcaacgac
atcacctttcgcattggatcttttggccctggggaggaccttctgtacctgcgggcatcc
gagatggcccgggcagagggcattcccaaaatctacgtggcagccaacagtggcgcccgt
attggcatggcagaggagatcaaacacatgttccacgtggcttgggtggacccagaagac
ccccacaaaggatttaaatacctgtacctgactccccaagactacaccagaatcagctcc
ctgaactccgtccactgtaaacacatcgaggaaggaggagaatccagatacatgatcacg
gatatcatcgggaaggatgatggcttgggcgtggagaatctgaggggctcaggcatgatt
gctggggagtcctctctggcttacgaagagatcgtcaccattagcttggtgacctgccga
gccattgggattggggcctacttggtgaggctgggccagcgagtgatccaggtggagaac
tcccacatcatcctcacaggagcaagtgctctcaacaaggtcctgggaagagaggtctac
acatccaacaaccagctgggtggcgttcagatcatgcattacaatggtgtctcccacatc
accgtgccagatgactttgagggggtttataccatcctggagtggctgtcctatatgcca
aaggataatcacagccctgtccctatcatcacaccaactgaccccattgacagagaaatt
gaattcctcccatccagagctccctacgacccccggtggatgcttgcaggaaggcctcac
ccaactctgaagggaacgtggcagagcggattctttgaccacggcagtttcaaggaaatc
atggcaccctgggcacagaccgtggtaacaggacgagcaaggcttggggggattcccgtg
ggagtgattgctgtggagacacggactgtggaggtggcagtccctgcagaccctgccaac
ctggattctgaggccaagataattcagcaggcaggacaggtgtggttcccagactcagcc
tacaaaaccgcccaggccatcaaggacttcaaccgggagaagttgcccctgatgatcttt
gccaactggagggggttctctggtggcatgaaagacatgtatgaccaggtgctgaagttt
ggagcctacatcgtggacggccttagacaatacaaacagcccatcctgatctatatcccg
ccctatgcggagctccggggaggctcctgggtggtcatagacgccaccatcaacccactg
tgcatagaaatgtatgcggacaaagagagcagggggggtgttctggaaccagaggggaca
gtggagattaagttccgaaagaaagatctgataaagtccatgagaaggctcgatccagct
tacaagaagctcatggaacagctaggggaacctgatctctccgacaaggaccgcaaggac
ctggagggccggctgaaagctcgcgaggacctgctgctccccatctaccaccaggtggcg
gtgcagttcgccgacttccacgacacgcccggccggatgctggagaagggcgtcatatct
gacatcctggagtggaagaccgcacgcaccttcctatattggcgtctgcgccgcctcctc
ctggaggaccaggtcaagcaggagatcctgcaggccagtggggagctgagtcacgtgcat
atccagtccatgctgcgccgctggttcgtggagacggagggggctgtcaaggcctacttg
tgggacaacaaccaggtggttgtgcagtggctggaacagcactggcaggcgggggatggc
ccgcgctccaccatccgtgagaacatcacgtacctgaagcacgactctgtcctcaagacc
atccgaggcctggttgaagaaaaccccgaggtggccgtggactgtgtgatatacctgagc
cagcacatcagcccagctgagcgggcgcaggtcgttcacctgctgtctaccatggacagc
ccggcctccacctga

DBGET integrated database retrieval system