KEGG   Pongo abelii (Sumatran orangutan): 100448476Help
Entry
100448476         CDS       T01416                                 

Gene name
ACACB
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100448476 (ACACB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100448476 (ACACB)
   00640 Propanoate metabolism
    100448476 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100448476 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100448476 (ACACB)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100448476 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100448476 (ACACB)
Enzymes [BR:pon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100448476 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100448476 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 1124 aa AA seqDB search
MTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTRNFDEVISCFANVPK
DTPLFSEARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVPILRTFVQSKKNILV
DYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPALAFQLELNRMRNFDLTAVP
CANHKMHLYLGAAKVKEGVEVTDHRFFIRAIIRHSDLITKEASFEYLQNEGERLLLEAMD
ELEVAFNNTSVRTDCNHIFLNFVPTVIMDPFKIEESVRYMVMRYGSRLWKLRVLQAEVKI
NIRQTTTGSAIPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSFGNKQGPQHGMLINT
PYVTKDLLQAKRFQAQSLGTTYIYDFPEMFRQALFKLWSSPDKYPKDILTYTELVLDSQG
QLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIGSFGPGEDLLYLRAS
EMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFKYLYLTPQDYTRISS
LNSVHCKHIEEGGESRYMITDIIGKDDGLGVENLRGSGMIAGESSLAYEEIVTISLVTCR
AIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQLGGVQIMHYNGVSHI
TVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPIDREIEFLPSRAPYDPRWMLAGRPH
PTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVETRTVEVAVPADPAN
LDSEAKIIQQAGQVWFPDSAYKTAQAIKDFNREKLPLMIFANWRGFSGGMKDMYDQVLKF
GAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYADKESRGGVLEPEGT
VEIKFRKKDLIKSMRRLDPAYKKLMEQLGEPDLSDKDRKDLEGRLKAREDLLLPIYHQVA
VQFADFHDTPGRMLEKGVISDILEWKTARTFLYWRLRRLLLEDQVKQEILQASGELSHVH
IQSMLRRWFVETEGAVKAYLWDNNQVVVQWLEQHWQAGDGPRSTIRENITYLKHDSVLKT
IRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLSTMDSPAST
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcccatcagtatcaccaaccctgacctgctgaggcacagcacagagctcttc
atggacagcggcttctccccactgtgccagcgcatgggagccatggtagccttcaggaga
ttcgaggacttcaccagaaattttgatgaagtcatctcttgctttgccaacgtgcccaaa
gacacccccctcttcagcgaggcccgcacctccctgtactccgaggatgactgcaagagc
ctcagagaagagcccatccacattctgaatgtgtccatccagtgtgcagaccacctggag
gatgaggcactggtgccgattttacggacgtttgtacagtccaagaaaaatatccttgtg
gattatggactccgacgaatcacattcttgattgcccaagagaaagaatttcccaagttt
ttcacattcagagcaagagatgagtttgcagaagatcgcatttaccgtcacttggaacct
gctctggccttccagctggaactcaaccggatgcgtaacttcgatctgaccgccgtgccc
tgtgccaaccacaagatgcacctttacctgggtgctgccaaggtgaaggaaggggtggaa
gtgacggaccataggttcttcatccgcgccatcatcaggcactccgacctgattacaaag
gaagcctccttcgaatacctgcagaacgagggtgagcggctgctcctggaggccatggac
gagctggaggtggcgttcaataacaccagcgtgcgaaccgactgcaaccacatcttcctc
aacttcgtgcccactgtcatcatggaccccttcaagatcgaggagtccgtgcgctacatg
gttatgcgctacggcagccggttgtggaaactccgcgtgctgcaggctgaggtcaagatc
aacatccgccagaccaccaccggcagtgccattcccatccgcctgttcatcaccaatgag
tcgggctactacctggacatcagcctctacaaagaagtgactgactccagatccggaaat
atcatgtttcactccttcggcaacaagcaagggccccagcacgggatgctgatcaatact
ccctacgtcaccaaggatctgctccaggccaagcgattccaggcccagtccctgggaacc
acctacatctatgacttcccggaaatgttcaggcaggctctctttaaactgtggagctcc
ccagacaagtatcccaaagacatcctgacatacactgaattagtgttggactctcagggc
cagctggtggagatgaaccgacttcctggtggaaatgaggtgggcatggtggccttcaaa
atgaggtttaagacccaggagtacccggaaggacgggacgtgatcgtcatcggcaacgac
atcacctttcgcattggatcttttggccctggggaggaccttctgtacctgcgggcatcc
gagatggcccgggcagagggcattcccaaaatctacgtggcagccaacagtggcgcccgt
attggcatggcagaggagatcaaacacatgttccacgtggcttgggtggacccagaagac
ccccacaaaggatttaaatacctgtacctgactccccaagactacaccagaatcagctcc
ctgaactccgtccactgtaaacacatcgaggaaggaggagaatccagatacatgatcacg
gatatcatcgggaaggatgatggcttgggcgtggagaatctgaggggctcaggcatgatt
gctggggagtcctctctggcttacgaagagatcgtcaccattagcttggtgacctgccga
gccattgggattggggcctacttggtgaggctgggccagcgagtgatccaggtggagaac
tcccacatcatcctcacaggagcaagtgctctcaacaaggtcctgggaagagaggtctac
acatccaacaaccagctgggtggcgttcagatcatgcattacaatggtgtctcccacatc
accgtgccagatgactttgagggggtttataccatcctggagtggctgtcctatatgcca
aaggataatcacagccctgtccctatcatcacaccaactgaccccattgacagagaaatt
gaattcctcccatccagagctccctacgacccccggtggatgcttgcaggaaggcctcac
ccaactctgaagggaacgtggcagagcggattctttgaccacggcagtttcaaggaaatc
atggcaccctgggcacagaccgtggtaacaggacgagcaaggcttggggggattcccgtg
ggagtgattgctgtggagacacggactgtggaggtggcagtccctgcagaccctgccaac
ctggattctgaggccaagataattcagcaggcaggacaggtgtggttcccagactcagcc
tacaaaaccgcccaggccatcaaggacttcaaccgggagaagttgcccctgatgatcttt
gccaactggagggggttctctggtggcatgaaagacatgtatgaccaggtgctgaagttt
ggagcctacatcgtggacggccttagacaatacaaacagcccatcctgatctatatcccg
ccctatgcggagctccggggaggctcctgggtggtcatagacgccaccatcaacccactg
tgcatagaaatgtatgcggacaaagagagcagggggggtgttctggaaccagaggggaca
gtggagattaagttccgaaagaaagatctgataaagtccatgagaaggctcgatccagct
tacaagaagctcatggaacagctaggggaacctgatctctccgacaaggaccgcaaggac
ctggagggccggctgaaagctcgcgaggacctgctgctccccatctaccaccaggtggcg
gtgcagttcgccgacttccacgacacgcccggccggatgctggagaagggcgtcatatct
gacatcctggagtggaagaccgcacgcaccttcctatattggcgtctgcgccgcctcctc
ctggaggaccaggtcaagcaggagatcctgcaggccagtggggagctgagtcacgtgcat
atccagtccatgctgcgccgctggttcgtggagacggagggggctgtcaaggcctacttg
tgggacaacaaccaggtggttgtgcagtggctggaacagcactggcaggcgggggatggc
ccgcgctccaccatccgtgagaacatcacgtacctgaagcacgactctgtcctcaagacc
atccgaggcctggttgaagaaaaccccgaggtggccgtggactgtgtgatatacctgagc
cagcacatcagcccagctgagcgggcgcaggtcgttcacctgctgtctaccatggacagc
ccggcctccacctga

DBGET integrated database retrieval system