KEGG   Pongo abelii (Sumatran orangutan): 100448922Help
Entry
100448922         CDS       T01416                                 

Gene name
MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100448922 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100448922 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    100448922 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100448922 (MOS)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100448922 (MOS)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100448922 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 346 aa AA seqDB search
MPSPLALRPYLRSELSPSVDARPCSSPSELPAKLLLGATPPRAPRLPRRLAWCSIDWEQV
CFLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSDSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCCTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIRRCWRPSAAQRPSARLLLVDLTSLKAEVG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctggccctacgcccctacctccggagcgagctttccccatcggtggac
gcgcggccctgcagcagtccctccgagcttcctgcgaagctgcttctgggggccactcct
cctcgggccccgcggctgccgcgccggctggcctggtgctccattgactgggagcaggtg
tgcttcctgcagaggctgggagccggaggatttggctcggtgtacaaggcgacttaccgc
ggtgttcctgtggccataaagcaagtgaacaagtgcaccaagaaccgactagcatctcgg
cggagtttctgggctgagctcaacgtagcaaggctgcgccacgataacatcgtgcgcgtg
gtggctgccagcacgcgcacgcccgcggggtccgatagcctagggaccatcatcatggag
ttcggtggcaacgtcactttacaccaagtcatctatggcgccgccggccaccctgagggg
gacgcaggggagcctcactgctgcactggaggacagttaagtttgggaaagtgtctcaag
tactccctagatgttgtgaacggcctgctcttcctccactcgcaaagcattgtgcacttg
gacctgaagcccgcgaacatcttgatcagtgagcaagatgtctgtaaaattagtgacttc
ggttgctctgagaagttggaagatctgctgtgcttccagacaccctcttaccctctagga
ggcacatacacccaccgcgccccggagctcctgaaaggagagggcgtgacgcctaaagcc
gacatttattcctttgccatcactctctggcaaatgactaccaagcaggcgccgtattcg
ggggagcggcagcacatactgtacgcagtggtggcctacgacctgcgcccgtccctctcc
gctgcagtcttcgaggactcgctccccgggcagcgccttggggacgtcatccggcgctgc
tggagacccagcgcggcgcagaggccgagcgcgcggctgcttttggtggatctcacctct
ttgaaagctgaagtcggctga

DBGET integrated database retrieval system