KEGG   Pongo abelii (Sumatran orangutan): 100448922Help
Entry
100448922         CDS       T01416                                 

Gene name
MOS
Definition
(RefSeq) MOS proto-oncogene, serine/threonine kinase
  KO
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100448922 (MOS)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100448922 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100448922 (MOS)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100448922 (MOS)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100448922 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
8
AA seq 346 aa AA seqDB search
MPSPLALRPYLRSELSPSVDARPCSSPSELPAKLLLGATPPRAPRLPRRLAWCSIDWEQV
CFLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSDSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCCTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIRRCWRPSAAQRPSARLLLVDLTSLKAEVG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctggccctacgcccctacctccggagcgagctttccccatcggtggac
gcgcggccctgcagcagtccctccgagcttcctgcgaagctgcttctgggggccactcct
cctcgggccccgcggctgccgcgccggctggcctggtgctccattgactgggagcaggtg
tgcttcctgcagaggctgggagccggaggatttggctcggtgtacaaggcgacttaccgc
ggtgttcctgtggccataaagcaagtgaacaagtgcaccaagaaccgactagcatctcgg
cggagtttctgggctgagctcaacgtagcaaggctgcgccacgataacatcgtgcgcgtg
gtggctgccagcacgcgcacgcccgcggggtccgatagcctagggaccatcatcatggag
ttcggtggcaacgtcactttacaccaagtcatctatggcgccgccggccaccctgagggg
gacgcaggggagcctcactgctgcactggaggacagttaagtttgggaaagtgtctcaag
tactccctagatgttgtgaacggcctgctcttcctccactcgcaaagcattgtgcacttg
gacctgaagcccgcgaacatcttgatcagtgagcaagatgtctgtaaaattagtgacttc
ggttgctctgagaagttggaagatctgctgtgcttccagacaccctcttaccctctagga
ggcacatacacccaccgcgccccggagctcctgaaaggagagggcgtgacgcctaaagcc
gacatttattcctttgccatcactctctggcaaatgactaccaagcaggcgccgtattcg
ggggagcggcagcacatactgtacgcagtggtggcctacgacctgcgcccgtccctctcc
gctgcagtcttcgaggactcgctccccgggcagcgccttggggacgtcatccggcgctgc
tggagacccagcgcggcgcagaggccgagcgcgcggctgcttttggtggatctcacctct
ttgaaagctgaagtcggctga

DBGET integrated database retrieval system