KEGG   Pongo abelii (Sumatran orangutan): 100448999Help
Entry
100448999         CDS       T01416                                 

Gene name
CACNA2D3
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-3
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04260  Cardiac muscle contraction
pon04261  Adrenergic signaling in cardiomyocytes
pon04921  Oxytocin signaling pathway
pon05410  Hypertrophic cardiomyopathy (HCM)
pon05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
pon05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100448999 (CACNA2D3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100448999 (CACNA2D3)
  Circulatory system
   04260 Cardiac muscle contraction
    100448999 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    100448999 (CACNA2D3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100448999 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100448999 (CACNA2D3)
   05414 Dilated cardiomyopathy (DCM)
    100448999 (CACNA2D3)
Ion channels [BR:pon04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100448999 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N dCache_1 VWA_3 VWA VWA_2 dCache_2 Cache_3-Cache_2 VWA_CoxE Phage_holin_6_1
Motif
Other DBs
NCBI-GeneID: 100448999
NCBI-ProteinID: XP_024100048
Position
3
AA seq 1085 aa AA seqDB search
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI
CSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQ
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLTDDQGPVLMTTVAMPVFSK
QNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRLLYEEG
KKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYY
TDIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRH
LSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVA
FLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIP
FSTGPVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASVDGKCS
ISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEIEGAVMNKLLTMGSFKRITLYDYQAM
CRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTTKAQKLKQTL
EPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESLAPIT
MAPIEIRYNESLKCERLKAQKIRRRPESCHGFHPEENARECGGAPSLQAQTVLLLLPLLL
MLFSR
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atggccgggccgggctcgccgcgccgcgcgtcccggggggcctcggcgcttctcgccgcc
gcgcttctctacgccgcgctgggggacgtggtgcgctcggagcagcagataccgctctcc
gtggtgaagctctgggcctcggcttttggtggggagataaaatccattgctgctaagtac
tccggttcccagcttctgcaaaagaaatacaaagagtatgagaaagatgttgccatagaa
gaaatcgatggcctccaactggtaaagaagctggcaaagaacatggaagagatgtttcac
aagaagtctgaggcagtcaggcgtctggtggaggctgcagaagaagcacacctgaaacat
gaatttgatgcagacttacagtatgaatacttcaatgctgtgctgataaatgaaagggac
aaagacgggaattttttggagctgggaaaggaattcatcttagccccaaatgaccatttt
aataatttgcctgtgaacatcagtctaagtgacgtccaagtaccaacgaacatgtacaac
aaagaccctgcaattgtcaatggtgtttattggtctgaatccctaaacaaagtttttgta
gataactttgaccgtgacccgtctctcatatggcagtacttcggaagtgcaaagggcttt
ttcaggcagtatccggggattaaatgggaaccagatgagaatggagtcattgccttcgac
tgcaggaaccgaaaatggtacatccaggcagcaacttctccgaaagacgtggtcatttta
gttgacgtcagtggcagcatgaaaggactccgtctcactatcgcgaagcaaacagtctca
tctattttggatacacttggcgatgatgacttcttcaacataattgcttataatgaggag
cttcactatgtggaaccttgcctgaatggaactttggtgcaagccgacaggacaaacaaa
gagcacttcagggagcatctggacaaactttttgccaaaggaattggaatgttggatata
gctctgaatgaggccttcaacattctgagtgatttcaaccacacgggacaaggaagtatc
tgcagtcaggccatcatgctcataactgatggggcagtggacacctatgatacaatcttt
gcgaaatacaattggccagatcgaaaggttcgcatcttcacatacctcattggacgagag
gctgcgtttgcagacaatctaaagtggatggcctgtgccaacaaaggattttttacccag
atctccaccttggctgatgtgcaggagaatgtcatggaataccttcacgtgctcagccgg
cctaaagtcatcgaccaggagcatgatgtggtgtggaccgaagcttacattgacagcact
ctgactgatgatcagggccccgtcctgatgaccactgtagccatgcctgtgtttagtaag
cagaacgaaaccagatcgaagggcattctcctgggagtggttggcacagatgtcccagtg
aaagaacttttgaagaccatccccaaatacaagttagggattcacggttatgcctttgca
atcacaaataatggatatatcctgacacatccagaactcaggctgctgtatgaagaagga
aaaaagcgaaggaaacctaactatagtagcgttgacctctctgaggtggagtgggaagac
cgagatgatgtgttgagaaatgctatggtgaatcgaaagacggggaagttttccatggag
gtgaagaagacagtggacaaagggaaacgggttttggtgatgacaaatgactactattat
acagacatcaagggtactcctttcagtttaggtgtggcgctttccagaggtcatgggaaa
tatttcttccgagggaatgtaaccatcgaagaaggcctgcatgacttagaacatcccgat
gtgtccttggcagatgaatggtcctactgcaacactgacctacaccctgagcaccgccat
ctgtctcagttagaagcgattaagctctacctaaaaggcaaagaacctctgctccagtgt
gataaagaattgatccaagaagtcctttttgacgccgtggtgagtgcccccattgaagcg
tattggaccagcctggccctcaacaaatctgagaattctgacaagggcgtggaggttgcc
ttcctcggcactcgcacgggcctctccagaatcaacctgtttgtcggggctgagcagctc
accaatcaggacttcctgaaagctggcgacaaggagaacatttttaacgcagaccatttc
cctctctggtaccgaagagctgctgagcagattccagggagctttgtctactcgatcccg
ttcagcactggaccagtcaataaaagcaatgtggtgacagcgagtacatccatccagctc
ctggatgaacggaaatctcctgtggtggcagctgtaggcattcagatgaaacttgaattt
ttccaaaggaagttctggactgccagcagacagtgtgcctccgtggatggcaaatgctcc
atcagctgtgatgatgagactgtgaattgttacctcatagacaataatggatttattttg
gtgtctgaagactacacacagactggagacttttttggtgagatcgagggagctgtgatg
aacaaattgctaacaatgggctcctttaaaagaattacactttatgactaccaagccatg
tgtagagccaacaaggaaagcagcgatggcgcccatggcctcctggatccttataatgcc
ttcctctctgcagtaaaatggatcatgacagaacttgtcttgttcctggtggaatttaac
ctctgcagttggtggcactccgatatgacaactaaagcccagaaattgaaacagaccctg
gagccttgtgatactgaatatccagcatttgtctctgagcgcactatcaaggagactaca
gggaatattgcttgtgaagactgctccaagtcctttgtcatccagcaaatcccaagcagc
aacctgttcatggtggtggtggacagcagctgcctctgtgaatctctggcccccatcacc
atggcacccattgaaatcaggtataatgaatcccttaagtgtgaacgtctaaaggcccag
aagatcagaaggcgcccagaatcttgtcatggcttccatcctgaggagaatgcaagggag
tgtgggggtgcgccgagtctccaagcccagacagtccttcttctgctccctctgcttttg
atgctcttctcaaggtga

DBGET integrated database retrieval system